CAZyme Information: MGYG000002560_02689

Basic Information

• Species: Phocaeicola sp902388365
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp902388365
• CAZyme ID: MGYG000002560_02689
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379	MGYG000002560_17|CGC1	43332.49	8.4829

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002560	5390440	MAG	China	Asia

• Gene Location: Start: 9078; End: 10217 Strand: -

Full Sequence      

MKYYLIVGEASGDLHASNLMRALKQEDSEAEFRFFGGDLMAAVGGMRVKHYKELAYMGFI
PVLLHLRTIFRNMKECKQDIIRWAPDVVILVDYPGFNLKIAEYIKKNTQIPVYYYISPKI
WAWKEYRIKNIKRDVDELFSILPFEINFFAGHQYPIHYVGNPCVDAVDAYRKGHNEEFEQ
FAADNGLPKKPVIALLAGSRKQEIKDNLPMMLEAAAPFTKNYQLVLAGAPGMDPAYYADY
ISKDVPVQIIFGQTYRLLQQAEAALVTSGTATLETALFRVPQVVCYYTPVGKFIAFLRRH
ILKVKYISLVNLVADKEVVRELVADTMTVRNIRSELDAILYNKVYREQMLQEYDRIIDIL
GPAGASEEAARQMVALLKK

Enzyme Prediction     

No EC number prediction in MGYG000002560_02689.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	357	2.7e-115	0.980225988700565

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	9.95e-101	1	379	2	377	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	2.86e-93	1	379	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	2.19e-71	4	353	2	354	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	5.72e-63	5	376	10	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	2.81e-50	1	379	2	346	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AII64873.1	2.25e-248	1	379	1	379
AND19645.1	2.25e-248	1	379	1	379
QJR71433.1	2.25e-248	1	379	1	379
QJR62835.1	2.25e-248	1	379	1	379
ALB75869.1	2.25e-248	1	379	1	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	4.98e-35	5	376	11	380	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.33e-34	5	376	11	380	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2LVL8	1.14e-64	5	379	8	380	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q39T49	3.31e-60	5	379	11	382	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q6ALW0	5.77e-58	5	377	14	386	Lipid-A-disaccharide synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) OX=177439 GN=lpxB PE=3 SV=1
Q74AT9	3.01e-57	5	379	11	382	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q1D393	4.12e-57	5	377	9	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002560_02689.