CAZyme Information: MGYG000002560_02856

Basic Information

• Species: Phocaeicola sp902388365
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp902388365
• CAZyme ID: MGYG000002560_02856
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
842	MGYG000002560_19|CGC1	97155.32	6.3072

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002560	5390440	MAG	China	Asia

• Gene Location: Start: 33364; End: 35892 Strand: +

Full Sequence      

MRKTINCFIPYVESTAAQQTIATLKESSIVNKIYLLAINPDKTLSTPEGCEILPVDSLTS
SATMQKIADRADRTYTLLYTKTSPLELGYMALERMVAFLQEKNTGMVYSDHFEWKNGEKR
KHPVNDYQPGSVRDDFDFGSVILFKSMYFIAGCYNMDKESKYAALYDIRLYLSFYYAITH
INEYLYTEIEDDNRRSGEKQFDYVNPRNREVQIEMEKVFTTYLKKTNAYLRPEFTDIDLK
EGDFAYQASVIIPVRNRARTIDDAIRSALAQETDFPFNIIVVDNHSTDGTTEIIHKYSDN
PKIIHLQPERTDLGIGGCWSIAVNHALCGRFAVQLDSDDLYSDTHTLQTIVDTFYKEQCA
MVIGSYRMTDFNLNTIAPGVIDHREWTEENGHNNALRINGLGAPRAFFTPLLREIGIPNV
SYGEDYALGLAFSRQYKIGRIYEVLYLCRRWEGNSDAALNIGQINANNHYKDSLRSLEIK
KRIDRNDQWKIKKQQVSSSIRTLFSKQLKSWKLAHDNYQALKKQKTKKFNVNGNLFVVQY
NSQRAISSTAKVDKESIEARPCFLCENNQPKEQESILIPCVSIAYRACVNPYPILPGHLT
LIYRKHIPQTLQDDDLFYNLYELIQNMPTYAIFYNGARCGASAPDHHHFQGVKAENIPFI
QNIQTWLAESQLIATEISYFDEECEDDGPEMNVTRLYINSKSYACPFFLIQDTGVGESLE
MFKYLMASLPKDEHDAEPMINLFYWKEEESYYTAIFPRSKHRPDRYFAEGEKQMLISPGA
LDMAGLIVAIREKDFRKITAEDIVDILKEVGLSKEEAAKVPKQYFIEKEAIQKRLREPRK
RN

Enzyme Prediction     

No EC number prediction in MGYG000002560_02856.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	249	379	7.4e-21	0.7529411764705882

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16269	DUF4922	6.08e-76	617	818	2	188	Domain of unknown function (DUF4922). This family consists of uncharacterized proteins around 310 residues in length and is mainly found in various Bacteroides and Parabacteroides species. Several members are annotated as putative glycosyltransferases, but the specific function of this family is still unknown.
cd00761	Glyco_tranf_GTA_type	2.57e-21	250	368	1	117	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam00535	Glycos_transf_2	3.68e-18	249	378	1	127	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd06433	GT_2_WfgS_like	1.62e-17	249	449	1	194	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG0463	WcaA	1.42e-15	249	551	6	291	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJR63544.1	0.0	1	828	1	820
QJR67806.1	0.0	1	828	1	820
QJR72142.1	0.0	1	828	1	820
QEW37331.1	0.0	1	828	1	820
QJR76211.1	0.0	1	828	1	820

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5TZE_C	5.64e-06	249	348	4	102	Crystalstructure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZE_E Crystal structure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZI_C Crystal structure of S. aureus TarS 1-349 [Staphylococcus aureus],5TZJ_A Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZJ_C Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZK_C Crystal structure of S. aureus TarS 1-349 in complex with UDP [Staphylococcus aureus]
5TZ8_A	7.89e-06	249	348	4	102	Crystalstructure of S. aureus TarS [Staphylococcus aureus],5TZ8_B Crystal structure of S. aureus TarS [Staphylococcus aureus],5TZ8_C Crystal structure of S. aureus TarS [Staphylococcus aureus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002560_02856.