CAZyme Information: MGYG000002560_03016

Basic Information

• Species: Phocaeicola sp902388365
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp902388365
• CAZyme ID: MGYG000002560_03016
• CAZy Family: GT8
• CAZyme Description: General stress protein A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
319	MGYG000002560_21|CGC2	37203.4	9.5431

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002560	5390440	MAG	China	Asia

• Gene Location: Start: 61791; End: 62750 Strand: +

Full Sequence      

METLTIAYATDENYAKLVWCSLKSLLENNANFFTVKAYIISDNLSNSSKDRLSNLISSYK
GKIYFIEFDSLAYGLDNACTFQNGKTAYARLFLAQIVKENKILYLDCDTLINYSLFDLWN
TNLEGYYVAGVKDIIAPQLKQDIQLLPSDIYINSGILLINIQEWKKNKIESQFIAYIKKM
NGKISCHDQGIINHVCKNKIKTISCTYNVMTPFFYLSSLQIKEIFDLKDYYNDIEIKAAI
SHPHILHFTAGWHIRVWYSNSKHPYAHLFKKYYNLSPWKEIPLPLGHLTLKIKVLRNIFK
ILPFSIYLKILRIKRERAK

Enzyme Prediction     

No EC number prediction in MGYG000002560_03016.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	5	249	1.8e-44	0.8404669260700389

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04194	GT8_A4GalT_like	4.95e-55	4	249	1	240	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
COG1442	RfaJ	8.01e-38	2	284	1	272	Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01501	Glyco_transf_8	5.12e-36	6	253	2	249	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
cd00505	Glyco_transf_8	8.40e-16	8	228	6	233	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
PRK15171	PRK15171	5.51e-13	3	283	25	296	lipopolysaccharide 3-alpha-galactosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT58558.1	7.39e-226	1	319	1	319
AXY10758.1	9.59e-75	4	306	3	307
QUG96983.1	9.59e-75	4	306	3	307
QDF23661.1	9.59e-75	4	306	3	307
QNF26192.1	3.83e-74	4	279	3	280

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1SS9_A	2.80e-17	4	210	1	210	ChainA, alpha-1,4-galactosyl transferase [Neisseria meningitidis]
1G9R_A	6.26e-16	6	208	3	208	ChainA, GLYCOSYL TRANSFERASE [Neisseria meningitidis],1GA8_A Chain A, GALACTOSYL TRANSFERASE LGTC [Neisseria meningitidis]
5GVW_A	6.32e-13	6	227	8	217	Crystalstructure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_B Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_C Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_D Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae]
5GVV_A	2.06e-12	6	227	8	217	Crystalstructure of the glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVV_F Crystal structure of the glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae]
6U4B_A	1.24e-09	2	249	300	562	ChainA, WbbM protein [Klebsiella pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P43974	1.47e-27	2	212	37	248	Putative glycosyltransferase HI_0258 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0258 PE=3 SV=2
P25148	9.05e-27	2	284	5	282	General stress protein A OS=Bacillus subtilis (strain 168) OX=224308 GN=gspA PE=1 SV=2
P19817	5.76e-17	2	282	24	295	Lipopolysaccharide 1,2-glucosyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaJ PE=3 SV=4
A0A0H2URH7	1.71e-16	2	281	301	549	Glycosyltransferase GlyA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyA PE=3 SV=1
Q9AEU2	3.26e-15	86	291	92	271	Probable glycosyl transferase Gly OS=Streptococcus gordonii OX=1302 GN=gly PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002560_03016.