CAZyme Information: MGYG000002560_03473

Basic Information

• Species: Phocaeicola sp902388365
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp902388365
• CAZyme ID: MGYG000002560_03473
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
560		61381.21	7.887

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002560	5390440	MAG	China	Asia

• Gene Location: Start: 61419; End: 63101 Strand: -

Full Sequence      

MNQLKKVFAVAAWSACVLPIAAQYPVIPDSVKARGDRQQEEIDRKSDEAWAKALPVVMSE
AAKGRPYKPWAAHPEDLIKSNIPAFPGAEGGGAYTPGGRGGKVIVVNSLADSGPGTLREA
CETGGARIIVFNVSGVIRLKSPINVRAPYITIAGQTAPGDGVCVTGASFLLDTHDIIIRH
MRFRRGAQDVAFRDDALGGNCIGNVIIDHCSGSWGLDENMSIYRHVYNRDSTGHGLKLPT
VNITIQNSIFSEGLDTYNHAFGATIGGHNSMFCRNLFASNISRNCSIGMNEDFNLVNNVT
YNWWNRSVDGGDETSRLNIINNYFKPGPITPKDKPIAHRIVKPESSRDRNKPDTFGKAYV
NGNVVEGNTRVTQNNWDGGVQVYDMPDAGKFTDQIRVNEPFPMPHVTVMDAKSAYNYVLE
NVGATFPKRDAVDTRVIKTVKTGKAIYVKDAPEFVSPYVKRRLPADSYKQGIITDIRQVG
GLPQYKGTPVVDTDGDGMPDAWEIKYGLDPNDPSDAVKDCNGDGYTNIEKYINGIDPTRK
VDWTDVKNNHDTLAKRKSLM

Enzyme Prediction     

No EC number prediction in MGYG000002560_03473.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	134	324	7e-64	0.994535519125683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam18884	TSP3_bac	5.42e-05	492	513	1	22	Bacterial TSP3 repeat. This entry contains a novel bacterial thrombospondin type 3 repeat which differs from the typical consensus by containing a glutamate in place of one of the calcium binding aspartate residues.
smart00656	Amb_all	0.005	149	324	17	186	Amb_all domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT84043.1	0.0	1	560	1	560
QJR68105.1	0.0	1	560	1	560
QJR55559.1	0.0	1	560	1	560
AII69027.1	0.0	1	560	1	560
ALA74794.1	0.0	1	560	1	560

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8NQQ7	2.76e-56	80	538	18	416	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1
Q2UB83	2.06e-54	80	538	18	416	Probable pectate lyase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=plyC PE=3 SV=1
Q4WL88	8.12e-51	84	538	23	417	Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyC PE=3 SV=1
B0XMA2	1.57e-50	84	538	23	417	Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyC PE=3 SV=1
A1DPF0	3.02e-50	84	538	23	417	Probable pectate lyase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.003878	0.699539	0.295373	0.000556	0.000350	0.000296

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002560_03473.