CAZyme Information: MGYG000002560_03501

Basic Information

• Species: Phocaeicola sp902388365
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp902388365
• CAZyme ID: MGYG000002560_03501
• CAZy Family: GH35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
782	MGYG000002560_30|CGC1	88407.92	5.2317

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002560	5390440	MAG	China	Asia

• Gene Location: Start: 31593; End: 33941 Strand: -

Full Sequence      

MKNLLTLLLALFLLAGCAGNKPGTFEAGKNTFLLNGKPFVIKAAEIHYPRIPREYWEHRI
EMCKALGMNTLCLYVFWNLHEETPGNYDFTGNKDIAAFCKLAQKHGMYVIVRPGPYVCAE
WEMGGLPWWLLKNDSVQLRTLDPFYMHHVGAFMHEVGKQLEDLQITRGGNIIMVQVENEY
GSYGTDKPYVSAICDTVRAAGFTEVPLFQCDWSSNFLNNGLDDLLWTVNFGIGADIDKQF
AKLKEVRPDAPLMCSEFWSGWFDHWGRKHETRDGQIMVDGLKEMMDKGISFSLYMAHGGT
TFGWWGGANNPAYSAMCSSYDYDAPISEAGWTTDKYFALRDMLKNYMDEGTTLPEVPEAL
PVMEVPAIRFTQIAPLINNLPEPKQTEAIQPMEKFDQGWGTILYRTKLPKDVKAGTVLRI
TEQHDWTQVFADGKLLGRLDRRAGEQELILPVLKAGTQLDLLVEAMGRVNFDKSIHDRKG
ITEKVELVSGKDTETLKGWTVYNFPVNYEFVSDKNFQDMNSSAACGIEQTDETVPAYYRA
TFTLDKVADTFLNMETWGKGMVWVNGHAMGRFWEIGPQQTLFMPGCWLKKGVNEIIVLDL
KGPEDATIVGLNKPILDMLRVAVPETHRKQGQTIKLNKEAPIATGTFKAGNGWQEVKVPA
TQGRYFCLEGLSSFDNTNVAAIAEFDVLDEKGQKISRENWKIVYADSEETRSGNRTADKI
YDLQESTFWQTVDNTAYPHQVVIDLGKEYTVTGFRILPRAEQGAPGMIKDYKVYVKANNF
DY

Enzyme Prediction     

No EC number prediction in MGYG000002560_03501.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	32	344	1.3e-118	0.993485342019544

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01301	Glyco_hydro_35	3.05e-151	31	344	1	316	Glycosyl hydrolases family 35.
PLN03059	PLN03059	1.35e-41	29	344	34	340	beta-galactosidase; Provisional
COG1874	GanA	8.21e-38	31	610	7	600	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam00754	F5_F8_type_C	1.97e-09	705	779	2	74	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam02449	Glyco_hydro_42	1.54e-08	48	181	3	139	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEW35199.1	0.0	1	782	1	782
ALK86780.1	0.0	1	782	3	784
QUT56492.1	0.0	1	782	1	782
ABR38205.1	0.0	1	782	1	782
QQY39504.1	0.0	1	782	1	782

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EON_A	0.0	2	780	3	777	GalactanaseBT0290 [Bacteroides thetaiotaomicron VPI-5482]
3D3A_A	2.60e-299	23	632	6	605	Crystalstructure of a beta-galactosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4MAD_A	2.34e-147	30	626	22	599	ChainA, Beta-galactosidase [Niallia circulans],4MAD_B Chain B, Beta-galactosidase [Niallia circulans]
7KDV_A	1.17e-120	16	616	9	629	ChainA, Beta-galactosidase [Mus musculus],7KDV_C Chain C, Beta-galactosidase [Mus musculus],7KDV_E Chain E, Beta-galactosidase [Mus musculus],7KDV_G Chain G, Beta-galactosidase [Mus musculus],7KDV_I Chain I, Beta-galactosidase [Mus musculus],7KDV_K Chain K, Beta-galactosidase [Mus musculus]
3WF3_A	3.21e-120	26	616	36	645	Crystalstructure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_B Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_C Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_D Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF4_A Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_B Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_C Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_D Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48982	4.23e-126	3	583	5	573	Beta-galactosidase OS=Xanthomonas manihotis OX=43353 GN=bga PE=1 SV=1
Q9TRY9	3.80e-123	18	616	28	645	Beta-galactosidase OS=Canis lupus familiaris OX=9615 GN=GLB1 PE=1 SV=3
Q60HF6	8.55e-122	3	616	7	644	Beta-galactosidase OS=Macaca fascicularis OX=9541 GN=GLB1 PE=2 SV=1
P23780	6.84e-121	8	616	12	646	Beta-galactosidase OS=Mus musculus OX=10090 GN=Glb1 PE=1 SV=1
P16278	8.03e-121	3	616	7	644	Beta-galactosidase OS=Homo sapiens OX=9606 GN=GLB1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000085	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002560_03501.