CAZyme Information: MGYG000002560_03976

Basic Information

• Species: Phocaeicola sp902388365
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp902388365
• CAZyme ID: MGYG000002560_03976
• CAZy Family: GH63
• CAZyme Description: Glucosidase YgjK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
645	MGYG000002560_41|CGC1	72967.13	5.2935

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002560	5390440	MAG	China	Asia

• Gene Location: Start: 11789; End: 13726 Strand: -

Full Sequence      

MKHKFTKIILLAAVVAGFFTASCTPATENTPTGKRYEFNNILDIAYTPDTLTRCRGWFTD
AGSWMGFTLPQKDKWVNGFCGPFSLDMNRRQWMAQSAVTVNFSDSSNTVFTPDSTCYFPG
ELYLSANSAEGQIIQRLNFLDASTALLRIHTDAGKDLSFTASEWGKDISVQTDQNTVIAR
HPSGEIVALTFTPDVTVESIPGNYTAKTNSSEHDTYVAISFYTGEKELSAGLQKTQLALS
HPHEGLQANKERWEGYLTKILRKDMKPEYDRIAVKAVVTLISNWRTRRGGLLHEGIVPSH
AAYYFVGFWAWDSWRFSAALAKFAPELAKDNIRAMFDYQQPDGMIIDCIYTDPAENNARD
SKPPLVSWAVDEIFTHTGDTAFISEMYPQLMAYYKWWYQKRDHNKNGMCEYGSTDGTLEA
AAWESGMDNAIRFDNTKMLKNEGADDAWSMDQESVDLNAYLALECKLLKKFAGILGVTFD
GPDNGAQVADYFFDKEKGFFFDRRLKDGSFIQEPGCEAYTPMWTEVATADQVKAMMPLLT
DTAKFSTYIPFPTVAADNPKYNPRGYWRGPIWLDQTYFAIRGLRNYGYNKMADEYTMQVF
DRLQGLKEGAPIHENYGTHTGELLKAPHFSWSSSHLLMLYDDYGK

Enzyme Prediction     

No EC number prediction in MGYG000002560_03976.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	209	643	6.5e-115	0.5421052631578948

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	2.80e-137	5	643	1	783	alpha-glucosidase; Provisional
COG3408	GDB1	1.35e-14	300	641	277	604	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam01204	Trehalase	2.54e-12	361	644	178	509	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
pfam03200	Glyco_hydro_63	3.35e-06	380	639	185	492	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
COG1626	TreA	5.52e-04	421	642	324	554	Neutral trehalase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJR61716.1	0.0	1	645	1	644
AII67042.1	0.0	1	645	1	644
AII61903.1	0.0	1	645	1	644
QJR75045.1	0.0	1	645	1	644
ALA72871.1	0.0	1	645	1	644

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	3.18e-77	58	643	32	756	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	1.65e-76	58	643	32	756	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	2.28e-76	58	643	32	756	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3D3I_A	1.60e-72	58	643	33	757	Crystalstructural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12],3D3I_B Crystal structural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12]
7PQQ_B	6.50e-40	58	414	358	769	ChainB, Anti-RON nanobody,Megabody 91,Glucosidase YgjK [Lama glama]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	2.62e-76	58	643	55	779	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
D8QTR2	4.20e-17	309	634	98	479	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
D8T3S4	9.87e-17	309	634	98	479	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1
P94250	4.82e-09	355	598	106	330	Uncharacterized protein BB_0381 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0381 PE=4 SV=2
K5BDL0	6.91e-07	295	637	26	442	Glucosylglycerate hydrolase OS=Mycolicibacterium hassiacum (strain DSM 44199 / CIP 105218 / JCM 12690 / 3849) OX=1122247 GN=ggh PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000001	0.000551	0.999502	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002560_03976.