CAZyme Information: MGYG000002560_04327

Basic Information

• Species: Phocaeicola sp902388365
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp902388365
• CAZyme ID: MGYG000002560_04327
• CAZy Family: GH106
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1092	MGYG000002560_56|CGC1	122802.5	6.655

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002560	5390440	MAG	China	Asia

• Gene Location: Start: 3460; End: 6738 Strand: -

Full Sequence      

MKKTLILISFLCCARLLSAESGIKSWKGIHEVPLAQLEQQFTAPPVEFANHVIWGWEGNM
DKKTICKDLDSIKSKGFHAVIFEAGYKLPFKYLSDEWFKAIRTGVLEAKKRGMKVWIIDE
GKYPSGFAGGKFSQERPDLRMQALVVCDTLHAKRGESLAHVQVMPEAISAVAISASGAPN
RTVEIKNGEINFQAGLDDWKILLVRSDFRTAVTRAVNNPNGGKDATNSLCDYLNPVAVQQ
FIDWTHEQYKKYLGKELGTTVLGFRGDEPDYAHMPWTPTIIRTFKERKGYDPTPYLASFF
TALPTLQEQRVKADYWDVWSDLFATNFFKLQADWCEANGVAHITHLNKEHEMPACVKAEG
DYFRDMSKVQIPGVDAIWNQIWPGTVNNFPKLASSVSHVYGKPRAFSESFAAYYTSPTIP
QAKYVVDYQITRGINFFEFMFWQAGSQHSNWMTDPGMKNLNEYTNRTTYLMTQGKPGARI
AMYYPTSTMWMGNNQIYDDIVTFTQQLLTHQRDFDYVNDDAFTEALTVGPGYLENKSGQR
YYTLIIPSADVISSPAWKTIEEFASRGGKVLFWGRKPSSLVDKTFTKPESIPDLPGIQYE
PATHWTARVNSILPEPEMKIVSPANDSIRYMRRVMPDGDLFFIFNEGSEVSHFTADFDKV
GIVKEWNAAEGTLQTINATVVNNRTRLDIKLEPWESKLISIEKSTREYNVKEYGVQGNGN
PETTALQNVIHKAAQQGGGTLVLPAGKYVSGALFFPRGVDLRIEKDAQLISTVNPDDFPV
IPTRFEGVERPWRCAFLNFNHSDGVKVYGEGTIDGKGVAWKDVPFGTSGRPRLICFTDCP
NGKISGLKMVNQASWCLHVLYTNGFTIDGVDIRALEYIPSSDGIDIDSSSDILITSTRIE
AHDDCISIKSGRDEDGLRVARPSENILIENCHFAYGHGGVAMGSEISGDIRNVTIRSCLM
DNENWSPLRFKSQPSRGGVVENITFEDITIKGARSIFDINMEWRMVPPILPAHYPLTRLR
NIRFKNITGEAQSVGTMYGFKEAPFQSDTFFFENCRIKAEKGLSISNAKDVKFEGLTLEV
AQGEKIYERAAK

Enzyme Prediction     

No EC number prediction in MGYG000002560_04327.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH106	37	718	2.8e-83	0.8021844660194175
GH28	734	1061	3.3e-73	0.916923076923077

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	8.85e-66	704	1000	79	405	Polygalacturonase [Carbohydrate transport and metabolism].
pfam17132	Glyco_hydro_106	1.88e-39	186	679	362	872	alpha-L-rhamnosidase.
pfam00295	Glyco_hydro_28	9.26e-32	759	1036	7	282	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
PLN02188	PLN02188	1.31e-20	704	1033	33	350	polygalacturonase/glycoside hydrolase family protein
PLN03010	PLN03010	1.37e-18	708	1085	47	381	polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABR37905.1	0.0	1	1091	1	1091
QQY39769.1	0.0	1	1091	1	1091
QQY43070.1	0.0	1	1091	1	1091
QUT56825.1	0.0	1	1091	1	1091
QJR61086.1	0.0	1	1091	1	1091

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OLP_A	1.23e-42	706	1061	43	424	Galacturonidase[Bacteroides thetaiotaomicron VPI-5482],5OLP_B Galacturonidase [Bacteroides thetaiotaomicron VPI-5482]
3JUR_A	1.25e-38	706	1003	26	362	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]
2UVE_A	3.48e-16	709	1084	158	588	Structureof Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVE_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVF_A Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica],2UVF_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica]
4C2L_A	3.36e-10	738	999	45	300	Crystalstructure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]
1NHC_A	1.37e-09	785	992	47	253	Structuralinsights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_B Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_C Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_D Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_E Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_F Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7PZL3	5.81e-28	712	997	67	365	Probable polygalacturonase OS=Vitis vinifera OX=29760 GN=GSVIVT00026920001 PE=1 SV=1
O22818	9.08e-20	709	1033	34	346	Probable polygalacturonase At2g43860 OS=Arabidopsis thaliana OX=3702 GN=At2g43860 PE=2 SV=1
Q6H9K0	5.07e-19	701	1029	3	318	Exopolygalacturonase (Fragment) OS=Platanus acerifolia OX=140101 GN=plaa2 PE=1 SV=1
P15922	7.29e-18	709	1077	153	574	Exo-poly-alpha-D-galacturonosidase OS=Dickeya chrysanthemi OX=556 GN=pehX PE=1 SV=1
Q9SFB7	5.43e-17	704	1029	67	382	Polygalacturonase QRT2 OS=Arabidopsis thaliana OX=3702 GN=QRT2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000327	0.998739	0.000434	0.000171	0.000148	0.000140

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002560_04327.