CAZyme Information: MGYG000002560_04328

Basic Information

• Species: Phocaeicola sp902388365
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp902388365
• CAZyme ID: MGYG000002560_04328
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
595	MGYG000002560_56|CGC1	66613.3	6.8555

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002560	5390440	MAG	China	Asia

• Gene Location: Start: 6740; End: 8527 Strand: -

Full Sequence      

MELINTIKKSIIAFTLLPTFLYAGIPPTLQDNASQRVTKDIMDRAYITPKRIVTKYAGSK
NNLIKDEHYLLIKSNGQSEMGRKNCCQMTSTETEKASILLDFGSELHGGLKLVLGSSSRR
QPSLVRIRFGESVEESNSTTLNSEWKVGFSTDDHAKRDIVMEVPRDGMIEIGNTGFRFVR
LDLLQDNTTISLKEVSAILRYRDIPYLGSFECSDARLNKIWITGAYTVHLNMQEYLWDGI
KRDRLVWLGDMHPELMTISRVFGYNEVIPNSLDLACQQFPLPGWMNGMSAYSLWYLINQY
EWYQQTGDMDFLKKHADYISGLIHQIDGKVDAEGNETLSPARFLDWPSSGNQAGVEAGYR
ALIVWAMQDASQLSSKLGNSSDSYLCLDIIDRMKKKILPHNNLKQAASLMAIAGLMDSQK
ACDEVVAVGGGKGFSTFYGYYMLEALAQAGEYEKAMEIIDSFWGAMLDLGATTFWEDFNL
DWIPNAAPIDEPVPAGKKDIHGDFGAYCYPGFRHSLCHGWSSGPTAWLSDHVLGIKIVNV
ERKQVSIKPHLGKLAWAKGTYPTPWGVIEVSHEKQPGGKIATKVKLPKGVKQVKL

Enzyme Prediction     

No EC number prediction in MGYG000002560_04328.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	92	591	2.8e-97	0.9841269841269841

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.37e-15	208	532	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	6.43e-04	543	591	10	58	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT56828.1	0.0	1	593	1	593
QQY39772.1	0.0	1	593	1	593
ABR37902.1	0.0	1	593	1	593
QQY43072.1	0.0	1	593	1	593
QJR65245.1	0.0	1	593	1	593

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	6.16e-43	77	570	173	674	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4XHC_A	1.15e-13	97	527	94	536	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.022144	0.971394	0.005659	0.000274	0.000260	0.000251

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002560_04328.