CAZyme Information: MGYG000002560_04339

Basic Information

• Species: Phocaeicola sp902388365
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp902388365
• CAZyme ID: MGYG000002560_04339
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
471	MGYG000002560_58|CGC1	53411.81	5.6475

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002560	5390440	MAG	China	Asia

• Gene Location: Start: 5131; End: 6546 Strand: +

Full Sequence      

MIKNLSTFLVGIALICLSGCTPAQKEAAATNEYTPLEVTIPERPAGQQDVIELVTPKLDT
VRVGFIGLGMRGPSAVERWTHIPGTKIVALCDLLPENAEKAQKIVTNAGMPAPTLYSGSE
DAWKQLCERDDIDLVYIATDWKHHAEMGIYAMEHGKHAAIEVPAAMSLDEIWALINTSER
TRKHCMQLENCVYDFFELTTLNMAQQGLFGEVLHVEGSYIHNLEEFWPYYWNNWRLDYNR
EFRGDVYATHGLGPACQLLNIHRGDRMKTLVAMDTKAVTGPELVKQYQNEEAPDFQNGDH
TMTFIRTENGKTIHIQHDVMNPRPYSRMYQLTGTKGFANKYPIEEYCFRPDQIKNDDVPN
HENLSMHSAVPEKVKEALMQKYKHPIHQELEETAKKVGGHGGMDFIMDYRLVYCLRNGLP
LDMDVYDLAEWCCMADLTRLSIENGSAPVAVPDFTRGGWNKVDGYHHAFAK

Enzyme Prediction     

No EC number prediction in MGYG000002560_04339.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	57	461	2e-168	0.9924812030075187

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	1.84e-22	60	362	3	281	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	7.21e-12	61	186	1	117	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
COG4091	COG4091	1.55e-07	61	157	18	128	Predicted homoserine dehydrogenase, contains C-terminal SAF domain [Amino acid transport and metabolism].
PRK11579	PRK11579	4.15e-04	59	235	3	164	putative oxidoreductase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJR53963.1	0.0	1	471	1	471
QJR61240.1	0.0	1	471	1	471
ALA72374.1	0.0	1	471	1	471
AII66549.1	0.0	1	471	1	471
AND18351.1	0.0	1	471	1	471

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	7.97e-90	43	459	25	438	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	1.21e-64	61	462	21	434	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
1OFG_A	4.91e-08	40	212	10	179	ChainA, Glucose-fructose Oxidoreductase [Zymomonas mobilis],1OFG_B Chain B, Glucose-fructose Oxidoreductase [Zymomonas mobilis],1OFG_C Chain C, Glucose-fructose Oxidoreductase [Zymomonas mobilis],1OFG_D Chain D, Glucose-fructose Oxidoreductase [Zymomonas mobilis],1OFG_E Chain E, Glucose-fructose Oxidoreductase [Zymomonas mobilis],1OFG_F Chain F, Glucose-fructose Oxidoreductase [Zymomonas mobilis]
1RYD_A	5.00e-08	40	212	16	185	ChainA, glucose-fructose oxidoreductase [Zymomonas mobilis],1RYD_B Chain B, glucose-fructose oxidoreductase [Zymomonas mobilis],1RYE_A Chain A, glucose-fructose oxidoreductase [Zymomonas mobilis],1RYE_B Chain B, glucose-fructose oxidoreductase [Zymomonas mobilis],1RYE_C Chain C, glucose-fructose oxidoreductase [Zymomonas mobilis],1RYE_D Chain D, glucose-fructose oxidoreductase [Zymomonas mobilis]
4H3V_A	5.05e-08	63	244	9	190	ChainA, Oxidoreductase domain protein [Kribbella flavida DSM 17836],4H3V_B Chain B, Oxidoreductase domain protein [Kribbella flavida DSM 17836]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6KX96	0.0	1	471	1	471	Glycosyl hydrolase family 109 protein 1 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0340 PE=3 SV=1
Q89ZX8	2.50e-280	1	471	1	467	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4243 PE=3 SV=1
Q5LGZ0	2.88e-276	1	471	1	464	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / NCTC 9343 / Onslow) OX=272559 GN=BF0853 PE=1 SV=1
P0C863	2.88e-276	1	471	1	464	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=BF0931 PE=3 SV=1
Q7MWF4	1.18e-262	10	471	11	468	Glycosyl hydrolase family 109 protein OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) OX=242619 GN=PG_0664 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000068	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002560_04339.