CAZyme Information: MGYG000002561_00777

Basic Information

• Species: Bacteroides sp902388495
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp902388495
• CAZyme ID: MGYG000002561_00777
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
358	MGYG000002561_4|CGC4	40542.12	7.6635

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002561	4554549	MAG	China	Asia

• Gene Location: Start: 165158; End: 166234 Strand: +

Full Sequence      

MRNSMKNMMMTLCSLLFCTIVNVEAACPKKWQTDLKTDLVVAQDGSGDYTTLQAAINAAP
DHSEKRFVIYIRNGKYDTEKLIIPKNKINITLKGEDRERTIISYHIYDCKSPDTGNKCPA
ESWALWKDNAELVRTSATLTIMADGCRMENLTLENTAGPVGQALALTVCGDKQVFRNCNI
LGYQDTIYLWTSGKRSYFENCLVLGRTDYIYGGGIGYFQSCEIRSWGGGWITAPSTLKEQ
KYGFVFNQCNFTYVDNSPRPGDDGRPVAIGRPWHNYPKVAILNSVMCEQMHPEGWPTTWN
MEYASTSEDLHLYEYNNTGKGADMSRRAKWAGIRKLTAAEAREYTCEKVFGEKIKDWK

Enzyme Prediction     

No EC number prediction in MGYG000002561_00777.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	39	350	1.6e-87	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01095	Pectinesterase	1.16e-78	38	345	1	290	Pectinesterase.
PLN02488	PLN02488	1.50e-59	38	350	198	492	probable pectinesterase/pectinesterase inhibitor
PLN02745	PLN02745	1.94e-57	35	347	283	576	Putative pectinesterase/pectinesterase inhibitor
PLN02301	PLN02301	6.65e-55	34	345	233	526	pectinesterase/pectinesterase inhibitor
PLN02990	PLN02990	6.85e-53	32	345	254	549	Probable pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWK06254.1	6.11e-130	28	349	19	337
APA00323.1	1.87e-127	15	349	14	339
AUS07041.1	3.83e-115	38	337	28	327
AXP82057.1	6.53e-115	38	344	470	770
AXP81337.1	7.68e-104	38	347	28	336

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	6.40e-35	40	349	6	297	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	4.89e-34	38	345	8	297	Pectinmethylesterase from Carrot [Daucus carota]
5C1E_A	2.09e-24	39	327	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	1.04e-23	39	327	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NTB_A	4.30e-21	40	352	7	336	Crystalstructure of pectin methylesterase in complex with hexasaccharide V [Dickeya dadantii 3937],2NTB_B Crystal structure of pectin methylesterase in complex with hexasaccharide V [Dickeya dadantii 3937],2NTP_A Crystal structure of pectin methylesterase in complex with hexasaccharide VI [Dickeya dadantii 3937],2NTP_B Crystal structure of pectin methylesterase in complex with hexasaccharide VI [Dickeya dadantii 3937],2NTQ_A Crystal structure of pectin methylesterase in complex with hexasaccharide VII [Dickeya dadantii 3937],2NTQ_B Crystal structure of pectin methylesterase in complex with hexasaccharide VII [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7Y201	5.56e-42	35	345	298	590	Probable pectinesterase/pectinesterase inhibitor 13 OS=Arabidopsis thaliana OX=3702 GN=PME13 PE=2 SV=2
Q3EAY9	1.68e-41	38	349	188	479	Probable pectinesterase 30 OS=Arabidopsis thaliana OX=3702 GN=PME30 PE=2 SV=1
Q43062	2.38e-40	35	345	205	498	Pectinesterase/pectinesterase inhibitor PPE8B OS=Prunus persica OX=3760 PE=2 SV=1
Q9SMY6	1.69e-39	35	345	293	585	Putative pectinesterase/pectinesterase inhibitor 45 OS=Arabidopsis thaliana OX=3702 GN=PME45 PE=2 SV=1
Q84JX1	3.28e-39	38	349	215	506	Probable pectinesterase/pectinesterase inhibitor 19 OS=Arabidopsis thaliana OX=3702 GN=PME19 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000260	0.999058	0.000215	0.000169	0.000147	0.000132

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002561_00777.