CAZyme Information: MGYG000002561_01958

Basic Information

• Species: Bacteroides sp902388495
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp902388495
• CAZyme ID: MGYG000002561_01958
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
543	MGYG000002561_12|CGC1	61024	5.4085

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002561	4554549	MAG	China	Asia

• Gene Location: Start: 73611; End: 75242 Strand: +

Full Sequence      

MRCKTILLLVLSAWGIMACQNYTDKITVEIRQPIYPVLTLKEHNPVLCLRLIRNSGVAYQ
LEKINFTLDGTVRSGDVVSASLFLDENCEQVCTSAKPVNKQLSFKVGRQIEEDTLTCWVT
LRLRDDAAQATSRIEISCNSVQTDLGLAGIRQLPAVKPLRIGVALRQSGQDGVHTSRIPG
LVTSTKGTLLALYDARNERDDDLQGDIDIAINRSEDGGRTWQPMQTVLDMKEWGGLPQKY
NGVSDGCILSDDFTGDLYVIGLWMHGVLDPKTGKWIENLTDTSTVWNHQWRAHGSQPGYG
VKQSSQFLISKSTDDGLTWSEPRNITRQVKKEKWWLLAPGPGRGITMEDGTLVFPVEGRN
EDGLQFSTIMWSKDKGENWTVGEPAYYNTNECQVVELSDHSLMLNMRERSNRGRQEGNGR
AIAVTADLGKTWTEHPTSRRALIEPACQASLLRHDYIEDGEERHVLLFANPNSKERRNNI
TIKVSFDDGQTWPEEYWMLLDEGRGAGYSCMTSIDEHTIGIFYEGSQADIQFQAIPLKEL
LKK

Enzyme Prediction     

No EC number prediction in MGYG000002561_01958.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	164	528	1.2e-94	0.9385964912280702

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	1.60e-96	163	536	1	339	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13859	BNR_3	1.05e-26	178	485	1	262	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
pfam13088	BNR_2	1.09e-25	187	509	1	266	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
pfam14873	BNR_assoc_N	7.82e-14	25	144	1	146	N-terminal domain of BNR-repeat neuraminidase. This domain is usually found at the N-terminus of the BNR-repeat neuraminidase protein family.
COG4409	NanH	1.39e-12	172	524	271	643	Neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT99124.1	0.0	1	543	1	543
QQA28368.1	0.0	1	543	1	543
QUT63699.1	0.0	1	543	1	543
QUT67768.1	0.0	1	543	1	543
QUT36411.1	0.0	1	543	1	543

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MYV_A	1.67e-116	27	542	3	522	Sialidase26co-crystallized with DANA-Gc [bacterium],6MYV_B Sialidase26 co-crystallized with DANA-Gc [bacterium],6MYV_C Sialidase26 co-crystallized with DANA-Gc [bacterium],6MYV_D Sialidase26 co-crystallized with DANA-Gc [bacterium]
6MRV_A	3.72e-116	27	542	24	543	Sialidase26co-crystallized with DANA [bacterium],6MRV_B Sialidase26 co-crystallized with DANA [bacterium],6MRX_A Sialidase26 apo [bacterium],6MRX_B Sialidase26 apo [bacterium],6MRX_C Sialidase26 apo [bacterium],6MRX_D Sialidase26 apo [bacterium]
4Q6K_A	1.91e-108	27	542	6	525	Crystalstructure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185],4Q6K_B Crystal structure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185],4Q6K_C Crystal structure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185],4Q6K_D Crystal structure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185]
4FJ6_A	2.82e-107	118	541	124	521	Crystalstructure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_B Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_C Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_D Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503]
4BBW_A	1.08e-102	118	542	145	544	Thecrystal structure of Sialidase VPI 5482 (BTSA) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P31206	2.65e-110	118	542	145	544	Sialidase OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=nanH PE=3 SV=2
P29767	9.18e-36	169	525	388	810	Sialidase OS=Clostridium septicum OX=1504 PE=3 SV=1
Q02834	5.59e-31	147	524	38	386	Sialidase OS=Micromonospora viridifaciens OX=1881 GN=nedA PE=1 SV=1
P10481	2.35e-25	177	543	37	381	Sialidase OS=Clostridium perfringens OX=1502 GN=nanH PE=1 SV=1
P15698	1.06e-24	177	526	55	382	Sialidase OS=Paeniclostridium sordellii OX=1505 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000319	0.158013	0.841475	0.000069	0.000073	0.000068

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002561_01958.