CAZyme Information: MGYG000002561_02223

Basic Information

• Species: Bacteroides sp902388495
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp902388495
• CAZyme ID: MGYG000002561_02223
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
506	MGYG000002561_15|CGC1	55192.3	4.933

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002561	4554549	MAG	China	Asia

• Gene Location: Start: 72140; End: 73660 Strand: -

Full Sequence      

MALLLATVTLSCSSSNTPEEESPYLTVKSVSSQTLPATGGEVIISVASYPAATAQSDAGW
MTLKSSTPLNEFTSFVFTAQANEGNAREAIITITAGEKKETVTIGQAQSDEPENETAIDE
NLPAVKVAKALGLGWNLGNQLDAHANEVADETSWGNGKATQETLNKVKDAGFTSVRIPIT
WLGKVGEAPGYTIDAAWLERAAEVVGYAEQAGLKAIINIHHDGHRQVNGDGSEEHHWLDI
VAAAKDETANTSIKEQLRAMWTQIAERFKEKGDFLIFEGLNEIHDGRWGSGTNTTDGGKQ
YAILNEWQQVFVDAVRATGGNNATRYLGISGYSTNPDLTMKHLKLPTDPAKDRLLVSVHY
YDPATFALEDKFSEWGHTGATGKKENWGDEEHLNGIFTALRSTYVEKGIPVYIGEMGCVH
RSSSRPESFRKYYLEYVCKAARTHGMSVFYWDNGNAGAGRECSGLMNHATGVYFNNGKEV
IDVMTKGYFSDDASYTLKSVYDRAPQ

Enzyme Prediction     

EC	3.2.1.4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	151	454	4.6e-96	0.9891304347826086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	2.66e-54	141	457	1	272	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	1.47e-26	129	417	49	322	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
cd14948	BACON	6.08e-13	24	107	1	83	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.
pfam19190	BACON_2	1.16e-06	31	109	7	91	Viral BACON domain. This family represents a distinct class of BACON domains found in crAss-like phages, the most common viral family in the human gut, in which they are found in tail fiber genes. This suggests they may play a role in phage-host interactions.
pfam13004	BACON	1.62e-05	53	107	4	61	Putative binding domain, N-terminal. The BACON (Bacteroidetes-Associated Carbohydrate-binding Often N-terminal) domain is an all-beta domain found in diverse architectures, principally in combination with carbohydrate-active enzymes and proteases. These architectures suggest a carbohydrate-binding function which is also supported by the nature of BACON's few conserved amino-acids. The phyletic distribution of BACON and other data tentatively suggest that it may frequently function to bind mucin. Further work with the characterized structure of a member of glycoside hydrolase family 5 enzyme, Structure 3ZMR, has found no evidence for carbohydrate-binding for this domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT35080.1	4.23e-297	1	506	12	517
AVM57519.1	1.10e-294	1	506	58	563
ADD61911.1	4.50e-291	23	506	2	485
QRX62664.1	2.10e-261	8	506	20	513
1814455A	3.41e-259	1	458	11	467

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WQY_A	2.34e-165	125	490	25	384	ChainA, Cellulase [Phocaeicola salanitronis DSM 18170]
4YHE_A	1.23e-135	124	506	7	386	NativeBacteroidetes-affiliated Gh5 Cellulase Linked With A Polysaccharide Utilization Locus [Bacteroidetes bacterium AC2a],4YHE_B Native Bacteroidetes-affiliated Gh5 Cellulase Linked With A Polysaccharide Utilization Locus [Bacteroidetes bacterium AC2a]
4YHG_A	9.94e-135	124	506	7	386	NativeBacteroidetes-affiliated Gh5 Cellulase Linked With A Polysaccharide Utilization Locus [Bacteroidetes bacterium AC2a],4YHG_B Native Bacteroidetes-affiliated Gh5 Cellulase Linked With A Polysaccharide Utilization Locus [Bacteroidetes bacterium AC2a]
2JEP_A	2.31e-81	124	457	35	367	Nativefamily 5 xyloglucanase from Paenibacillus pabuli [Paenibacillus pabuli],2JEP_B Native family 5 xyloglucanase from Paenibacillus pabuli [Paenibacillus pabuli],2JEQ_A Family 5 xyloglucanase from Paenibacillus pabuli in complex with ligand [Paenibacillus pabuli]
3NDY_A	6.22e-64	121	487	9	340	Thestructure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDY_B The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDY_C The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDY_D The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDZ_A The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans],3NDZ_B The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans],3NDZ_C The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans],3NDZ_D The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O08342	2.28e-75	121	454	37	369	Endoglucanase A OS=Paenibacillus barcinonensis OX=198119 GN=celA PE=1 SV=1
P28623	1.73e-61	121	487	40	371	Endoglucanase D OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engD PE=1 SV=2
Q12647	1.11e-56	120	470	21	347	Endoglucanase B OS=Neocallimastix patriciarum OX=4758 GN=CELB PE=2 SV=1
P28621	1.06e-55	121	461	39	348	Endoglucanase B OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engB PE=3 SV=1
P23660	6.48e-55	121	476	24	353	Endoglucanase A OS=Ruminococcus albus OX=1264 GN=celA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000003	0.000027	1.000010	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002561_02223.