CAZyme Information: MGYG000002561_02229

Basic Information

• Species: Bacteroides sp902388495
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp902388495
• CAZyme ID: MGYG000002561_02229
• CAZy Family: GH20
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
560	MGYG000002561_15|CGC1	63157.01	5.5488

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002561	4554549	MAG	China	Asia

• Gene Location: Start: 86550; End: 88232 Strand: -

Full Sequence      

MRKLNQMLLAGVIALACSSCQKSVEANFQTIVPLPQEVNPTQDGSFRLSKSTTIAYPEGN
DLLKRNAEFLAQYIGQVINGTPKTKAIAPGEAAGKKSIMLSLDPGIENKEGYVLDVTPEA
VTIKGQTENGVFYGIQTLRKSMPPTDTETANILLPTGTIKDAPRFAYRGMHLDVGRHFFP
VEFIKRYIDLLALHNMNTFHWHLTEDQGWRIEIKKYPKLTEIGSIRNRTVIGRNTQEYDN
TPYGGFYTQEQAREIVKYAQERYITVIPEVDLPGHMLAALAAYPEMGCTGGPYEVCPRWG
VFEDVLCIGNEQSMQFLEDVMAEIIEIFPSKLIHIGGDEAPRTRWQKCPKCQARIKAEGL
KADKEHTAEDRLQSYCMTRIEKFLNSKGRSIIGWDEILEGDVAPNATVMSWRGSAGGIKA
AQLGHDVIMTPNNFCYFDYYQTDDTANEPLGIGGYVPLEKVYSLEPTASLTEEQAKHILG
AQANLWTEYIATPEHVEYMVLPRMAALAEVQWMQPEKKNYEDFLNQRLPRLVKFYDRDGV
NYCKHAFEKKEERPADSAVE

Enzyme Prediction     

EC	3.2.1.52	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH20	160	514	3.9e-128	0.973293768545994

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06563	GH20_chitobiase-like	0.0	165	528	1	357	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This GH20 domain family includes an N-acetylglucosamidase (GlcNAcase A) from Pseudoalteromonas piscicida and an N-acetylhexosaminidase (SpHex) from Streptomyces plicatus. SpHex lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
pfam00728	Glyco_hydro_20	0.0	165	512	1	343	Glycosyl hydrolase family 20, catalytic domain. This domain has a TIM barrel fold.
COG3525	Chb	2.50e-130	110	533	206	637	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
cd06568	GH20_SpHex_like	1.69e-107	165	523	1	325	A subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the N-acetylhexosaminidase from Streptomyces plicatus (SpHex). SpHex catalyzes the hydrolysis of N-acetyl-beta-hexosaminides. An Asp residue within the active site plays a critical role in substrate-assisted catalysis by orienting the 2-acetamido group and stabilizing the transition state. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself. Proteins belonging to this subgroup lack the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases.
cd06570	GH20_chitobiase-like_1	8.34e-100	165	528	1	311	A functionally uncharacterized subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the chitobiase of Serratia marcescens, a beta-N-1,4-acetylhexosaminidase that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This subgroup lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ60692.1	0.0	1	550	1	546
QUT88324.1	0.0	1	550	1	546
QDO68883.1	0.0	1	550	1	547
QMI80192.1	0.0	1	542	1	539
QPH59098.1	0.0	1	542	1	539

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Q63_A	2.05e-256	9	560	7	557	BT0459[Bacteroides thetaiotaomicron],6Q63_B BT0459 [Bacteroides thetaiotaomicron],6Q63_C BT0459 [Bacteroides thetaiotaomicron]
7CBN_A	4.14e-119	32	542	14	510	Crystalstructure of beta-N-acetylhexosaminidase Am0868 from Akkermansia muciniphila [Akkermansia muciniphila ATCC BAA-835],7CBO_A Crystal structure of beta-N-acetylhexosaminidase Am0868 from Akkermansia muciniphila in complex with GlcNAc [Akkermansia muciniphila ATCC BAA-835]
7DUP_A	5.50e-112	29	545	2	523	ChainA, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVA_A Chain A, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVA_B Chain B, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron]
3RCN_A	1.42e-111	28	542	7	513	CrystalStructure of Beta-N-Acetylhexosaminidase from Arthrobacter aurescens [Paenarthrobacter aurescens TC1]
7DVB_A	3.07e-111	29	545	2	523	ChainA, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVB_B Chain B, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVB_C Chain C, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVB_D Chain D, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49008	2.50e-146	15	542	17	532	Beta-hexosaminidase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) OX=242619 GN=nahA PE=3 SV=2
B2UQG6	3.15e-118	32	542	33	529	Beta-hexosaminidase Amuc_0868 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_0868 PE=1 SV=1
P96155	2.02e-89	13	508	119	601	Beta-hexosaminidase OS=Vibrio furnissii OX=29494 GN=exoI PE=1 SV=1
B2UP57	9.04e-72	96	523	42	458	Beta-hexosaminidase Amuc_2018 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_2018 PE=1 SV=1
Q7WUL4	5.21e-63	31	542	6	477	Beta-N-acetylhexosaminidase OS=Cellulomonas fimi OX=1708 GN=hex20 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000004	0.001885	0.998128	0.000001	0.000001	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002561_02229.