CAZyme Information: MGYG000002561_02531

Basic Information

• Species: Bacteroides sp902388495
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp902388495
• CAZyme ID: MGYG000002561_02531
• CAZy Family: GH50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
651		74040.92	5.2106

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002561	4554549	MAG	China	Asia

• Gene Location: Start: 27151; End: 29106 Strand: -

Full Sequence      

MKNKVKTILLSALAASLFVQCTPTEQTFKVELDSTKEVSGKKFALKDINPQLPTDWDAYK
FVVIEYKSTTAQRFQLGFTTDSGYNELRIMCYVPNAWNKLAIPLKYFTELPDAAVDLAAT
FNHARYTGWINLGGKRGPLQGVDSIGIRMRKPIHNPTIEIRSITLATEDPGDVYMGDIPA
VDEFGQSNLVEYAGKVSSLEQLKKEWEEEDNEVVTTDAYNYSKFGGYKQQRVKATGFFHT
QKIGDRWWFVDPEGYLFLSVGVDCVSPGGGGNVRDIDKRDGMYKELPPADLMAKVSGRNY
RGNNSASFGFWNQYRRYGDDFPEKSKELIFKRMDKWGLNTIANWSSGEVMNMNRKAFLIP
LRDIGIEHDLMGLCDVYDPVFKAKVDKSLAEFVAPYKNNPWLIGYFIGNEPAWLDEEARL
CGLILDGKDRPIKTALKKYLEENGDTAENRKEFVFSTFRTFLATTNQLLKKHDPNHLNLG
IRFGNILELDEEILEMCGESFDVLSFNCYDLVPNPAMLDRALKIAKLPMIIGEYHFGTVD
RGMAQSLWQVDSQEQRGVAYRYYTENAYAHPGLIGTGYFQWCDQDLTGRRDGENYNCGLV
DVTDRPYKEQVEAMMETAKVLYDVHSGTKAPIDRKPENARGHEAIPDLWNE

Enzyme Prediction     

No EC number prediction in MGYG000002561_02531.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH50	138	622	3.5e-91	0.8361408882082695

CDD Domains     

MGYG000002561_02531 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBE17136.1	0.0	12	651	34	667
AXP07832.1	0.0	26	651	25	645
SCM56829.1	0.0	11	649	9	644
AHF13634.1	3.49e-302	21	650	20	646
ASB49335.1	2.93e-267	4	651	2	646

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6XJ9_A	2.02e-56	49	623	76	760	Structureof PfGH50B [Pseudoalteromonas fuliginea],6XJ9_B Structure of PfGH50B [Pseudoalteromonas fuliginea]
4BQ2_A	1.88e-54	133	629	157	750	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
4BQ4_A	4.82e-54	133	629	157	750	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ4_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
5Z6P_A	9.72e-47	181	622	223	759	Thecrystal structure of an agarase, AgWH50C [Agarivorans gilvus],5Z6P_B The crystal structure of an agarase, AgWH50C [Agarivorans gilvus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48840	1.50e-43	128	622	383	949	Beta-agarase B OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaB PE=3 SV=1
P48839	4.45e-33	182	616	400	907	Beta-agarase A OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000002	0.000620	0.999424	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002561_02531.