CAZyme Information: MGYG000002561_02754

Basic Information

• Species: Bacteroides sp902388495
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp902388495
• CAZyme ID: MGYG000002561_02754
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1021	MGYG000002561_24|CGC4	113259.94	9.7177

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002561	4554549	MAG	China	Asia

• Gene Location: Start: 50176; End: 53241 Strand: +

Full Sequence      

MKRLFLLTLIVLICFVHPVLRAQTVPFLPPAGSPSAESPAMPSLVRPLQNDARCRQWVDS
VLQRLTLKERIGQLFIYTIAPQTDKANKELLHKVVDDYKVGGLLFSGGLMQNQAVLTNEA
QRMADVPLMITFDGEWGLAMRLRGTPTFPKNRVLGCIQNDSLIYEYGREMARQCRELGVQ
VNFAPVADVDINPKNPVINTRSFGESPSGVADKVIAYSRGLEAGGVLSVSKHFPGHGDTD
ADSHKTLPILSFTRARLDSVELYPFKRVIRAGLGGIMVGHLEVPALEKQKGVPSSLSRSV
VHDLLASELHFQGLIFTDALAMKGVSTNASVCLQALKAGNDVLLVPRRIKEEVEAILAAV
KSGELTESEIEQKCRKVLMYKYALGLTKKPYVRLSGLGTRINTPQTRELIRRLNLAAITV
LDNKSKVLPLDPFIKEVAVLNVGAPQEIQPFIKELSRYTHPVEFRLGQNLPEAEAGRLRE
TLAKYKRILVCVTEHRLAPYQAFFARFAPDVPVVYLCFIPGRQILQINRGIASADAVVLA
HSSNDDVQQQTARILYSSAGADGRLSSSIGSLFAAGTGITLNQQSTPHFVPDEHGINARL
LAEIDKIAEEGIREGAYPGCQVVVLKDGKEMYNKAFGTHTWNKTAVAATGKKPVLPVKKT
DVYDIASLTKTTATLLAVMKLYDSGRLNLTDRVSDYLPFLQDTNKKNITVRELLMHESGL
PSTILFYQEAIDKESYSGTLFKARADAQHTARIARQTWANPKFRFRQGLTSKVGTAEYTM
QVCDSLWLHRSFKQEYLQKIVDAPLRDKRYRYSCVGFILLQQLVEARTGMPMDEYLAREF
YTPMGLKRTGYLPLRFLKKEEIIPSSVDPFLRKTTLQGFVHDESAAFLGGVSGNAGLFSS
AEEVAKVYQMILNGGELDGKRYLSKETCKVFTTTVSRISRRGLGFDKPSRTGQGGPCAPS
APASVYGHTGFTGTCAWVDPDNGLVYVFLSNRIYPNVWNNKLMQLDIRPRIQEAIYKAMK
K

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	121	345	6.2e-54	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	2.47e-75	65	444	1	364	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	8.49e-75	66	378	1	314	Glycosyl hydrolase family 3 N terminal domain.
PRK03642	PRK03642	7.97e-60	591	1020	30	432	putative periplasmic esterase; Provisional
pfam00144	Beta-lactamase	2.42e-45	604	997	1	313	Beta-lactamase. This family appears to be distantly related to pfam00905 and PF00768 D-alanyl-D-alanine carboxypeptidase.
COG1680	AmpC	3.43e-42	564	996	1	367	CubicO group peptidase, beta-lactamase class C family [Defense mechanisms].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT62072.1	0.0	1	1019	1	1009
QQA30538.1	0.0	1	1019	1	1009
QUT65080.1	0.0	1	1019	1	1009
QUT33687.1	0.0	1	1019	1	1008
QBJ17996.1	0.0	1	1019	1	1009

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	2.05e-59	65	565	11	527	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3SQL_A	1.79e-54	58	410	12	372	CrystalStructure of Glycoside Hydrolase from Synechococcus [Synechococcus sp. PCC 7002],3SQL_B Crystal Structure of Glycoside Hydrolase from Synechococcus [Synechococcus sp. PCC 7002],3SQM_A Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_B Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_C Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_D Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002]
3BMX_A	9.06e-54	59	449	36	464	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	2.68e-53	59	449	10	438	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	4.48e-53	59	449	40	468	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	4.96e-53	59	449	36	464	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	5.09e-45	91	430	55	425	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
P77619	1.50e-43	591	1020	30	432	Putative D-alanyl-D-alanine carboxypeptidase OS=Escherichia coli (strain K12) OX=83333 GN=yfeW PE=1 SV=2
O05213	1.44e-42	597	1019	45	440	N-acetylmuramyl-L-alanine amidase OS=Bacillus subtilis (strain 168) OX=224308 GN=amiE PE=1 SV=3
Q8XBJ0	4.19e-42	591	1020	30	432	Putative D-alanyl-D-alanine carboxypeptidase OS=Escherichia coli O157:H7 OX=83334 GN=yfeW PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000244	0.999179	0.000157	0.000149	0.000137	0.000133

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002561_02754.