CAZyme Information: MGYG000002562_00744

Basic Information

• Species: Dialister sp900557365
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Dialisteraceae; Dialister; Dialister sp900557365
• CAZyme ID: MGYG000002562_00744
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
204	MGYG000002562_3|CGC1	22944.35	6.1248

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002562	1679141	MAG	China	Asia

• Gene Location: Start: 50312; End: 50926 Strand: -

Full Sequence      

MMRTALKHRKREVSRHQGNTGAMVFTLFLALLCILTLVIIRNNLLLRPDARVSRIIQVSA
AEEKISPALLEAVILTESKFDEKAVSHVGAVGLMQLMPETAQWISEESGLPADELSQPEQ
NIPLGAWYINYLLKKYHNNEVLALAAYNAGRGNVDEWIQKEGWSEGFSDPDRIPFPETRE
FVKAVTSSRDRLLEEMAKEQKNGG

Enzyme Prediction     

No EC number prediction in MGYG000002562_00744.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	63	194	1.3e-30	0.8444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	3.51e-72	55	191	7	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	5.98e-55	55	189	9	146	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	1.64e-43	67	187	1	108	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	7.10e-36	60	167	3	112	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	4.80e-31	51	201	138	296	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK24355.1	2.25e-99	2	201	1	200
AOH39655.1	1.22e-66	18	202	13	196
CCC73618.1	1.26e-47	60	185	18	146
AVO73570.1	3.36e-47	60	185	50	178
AVO26251.1	3.36e-47	60	185	50	178

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5O1J_A	1.59e-21	60	188	428	555	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5MPQ_A	1.59e-21	60	188	424	551	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
6FPN_B	1.60e-21	60	188	434	561	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	1.61e-21	60	188	438	565	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	1.62e-21	60	188	444	571	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	4.88e-20	49	187	57	177	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
P39434	4.89e-17	65	185	493	618	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P0AGC3	4.16e-16	63	185	491	618	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	4.16e-16	63	185	491	618	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
O64046	9.10e-16	49	193	1419	1545	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000023	0.000035	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
21	40