CAZyme Information: MGYG000002562_01448

Basic Information

• Species: Dialister sp900557365
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Dialisteraceae; Dialister; Dialister sp900557365
• CAZyme ID: MGYG000002562_01448
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380	MGYG000002562_8|CGC1	41949.12	6.908

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002562	1679141	MAG	China	Asia

• Gene Location: Start: 18996; End: 20138 Strand: +

Full Sequence      

MKIMMSAGEASGDMHAGAVAAEIKKQMPDAEIFGMGGADMRRSGVRIIYDIENLGIIGVV
EVIKHIPFFFRLRDFLKKAMTEEKPDVLVCVDYPGFNMKLAHTAKELGIPVVYYIAPTIW
AWHRSRAKSIVRDVKRVASIFPFEARAYEEAGAPVTFVGHPLVDLVHPSMSFEEAMAHFG
GKADKKRILLMPGSRKNEVSGLLPDMVKAAAELSKKADCQFFIPRASTIPMDFLQDILKK
EPDVSFIVTEGNQYDLMQICDACIASSGTATLETALMELPTVLVYRLAPLTWKLANLLVH
VEFAGLPNLLMNREVTPELLQEDVSPENMVKILLPWITDPAAREKNVKELKKVRTALGGG
GALRRTADLILETAGAENGR

Enzyme Prediction     

No EC number prediction in MGYG000002562_01448.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	3	357	1.2e-123	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	6.83e-135	1	379	2	380	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.03e-121	1	376	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	7.17e-94	3	358	1	360	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.63e-84	3	372	8	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	5.10e-59	1	372	2	346	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK24321.1	1.66e-188	1	375	1	375
AOH38760.1	1.17e-176	1	378	1	378
SNV60281.1	1.65e-145	1	374	1	374
CAB1276542.1	3.59e-142	1	370	1	370
VEG93955.1	5.10e-142	1	370	1	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	1.61e-56	1	339	7	347	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	4.45e-56	1	339	7	347	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q74AT9	7.71e-97	2	375	8	381	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q39T49	7.90e-94	2	375	8	381	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
B3E4H8	6.92e-92	2	371	8	377	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q2LVL8	1.42e-85	3	371	6	375	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q1D393	7.11e-83	2	372	6	376	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999873	0.000162	0.000003	0.000001	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002562_01448.