CAZyme Information: MGYG000002564_00008

Basic Information

• Species: CAG-831 sp902388455
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; CAG-831; CAG-831 sp902388455
• CAZyme ID: MGYG000002564_00008
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
439		49240.13	4.8313

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002564	2497816	MAG	China	Asia

• Gene Location: Start: 7684; End: 9003 Strand: -

Full Sequence      

MEIIDRDNGYVLLRVGPEREMYDAGQAGGRLLEEAVRTGAAMVYCDYWLRTSDGRQKDNP
VNDYQPGSVREDFDFGALVAVNEDLMEKWEQETAEGNAEGGTVLKYGRWYSLRLFLSRHG
ALVHLPQMLYGVDEVDPRASGQKQFDYVDPRNREAQIEMEAIFTDHLRKIGAWLPQRTRT
VGEDGGIYAVEASVIIPVLNRAATIQDALRSALSQQTDFPFNVIVIDNHSTDGTSERIDE
LASSDSRVIHVIPEETGLCIGGCWNAGINHPACGRYAVQLDSDDMYSGPDTLQRIVDVFR
CERCAVVIGSYMMTDFDLRPIPPGVIDHREWTDSNGHNNALRINGLGAPRAFHTATLRSV
GGFENVSYGEDYGVVLRLTREYRLCRIYDPVYSCRRWGGNSDAALDISKINAHNAYKDSL
RTRELLARQQMNGNMITSL

Enzyme Prediction     

No EC number prediction in MGYG000002564_00008.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	193	346	5e-22	0.8764705882352941

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00761	Glyco_tranf_GTA_type	1.77e-21	194	309	1	113	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam00535	Glycos_transf_2	5.16e-20	193	358	1	160	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG0463	WcaA	3.80e-19	193	317	6	121	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd06433	GT_2_WfgS_like	7.71e-17	193	402	1	200	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd06423	CESA_like	9.07e-16	194	371	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATV53621.1	1.73e-149	30	432	97	492
AWX07615.1	2.46e-149	30	432	97	492
APW34203.1	2.46e-149	30	432	97	492
BAR96143.1	2.46e-149	30	432	97	492
QUB48312.1	9.89e-149	30	432	97	492

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32268	2.91e-06	193	321	9	133	Putative teichuronic acid biosynthesis glycosyltransferase TuaG OS=Bacillus subtilis (strain 168) OX=224308 GN=tuaG PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002564_00008.