CAZyme Information: MGYG000002564_01101

Basic Information

• Species: CAG-831 sp902388455
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; CAG-831; CAG-831 sp902388455
• CAZyme ID: MGYG000002564_01101
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
335	MGYG000002564_7|CGC3	38691.19	9.6985

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002564	2497816	MAG	China	Asia

• Gene Location: Start: 83546; End: 84553 Strand: +

Full Sequence      

MIQTLHFKKIQALITGAVAAAVLILTALPGYSQQQQTREEYIEKYKDAAIQYMKTHGIPA
SITLAQGCLESANGNSDLAVRANNHFGIKCHNDWKGPTYYKKGDDPGKSCYRKYRSASES
FKDHSDFLRYGQRYAFLFDLQITDYKGWSHGLKKAGYATDPKYAQKLIKIIEDYQLYRFD
REIYAKAEKKPDLLPPSPSQLQQVMELNPAKNSLLYKYSRNRTIYVRNGVPFILAGDLDT
YESIAEEYNLFTGELLRFNDLKKSRDLVPGTVVYLQRKKGKAQKHLEIHIAVEGDTYYDV
SQKYGVRMKKLFKYNDYKSGDILHIGDEIFLRRHR

Enzyme Prediction     

No EC number prediction in MGYG000002564_01101.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	47	176	7.3e-37	0.9765625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF038016	sporang_Gsm	1.20e-38	18	180	135	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
COG1705	FlgJ	2.03e-37	8	181	2	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
pfam01832	Glucosaminidase	3.06e-28	46	176	1	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
smart00047	LYZ2	1.80e-25	39	180	9	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
TIGR02541	flagell_FlgJ	4.42e-19	39	171	149	290	flagellar rod assembly protein/muramidase FlgJ. The N-terminal region of this protein acts directly in flagellar rod assembly. The C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGY53917.1	3.11e-115	16	332	6	312
QKG80574.1	1.12e-87	1	333	1	309
QUT39336.1	5.63e-85	23	332	14	301
QUT71786.1	5.63e-85	23	332	14	301
QQA10134.1	5.63e-85	23	332	14	301

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5T1Q_A	3.84e-11	40	182	62	214	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
5DN5_A	3.28e-10	57	172	22	146	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	4.30e-10	57	172	22	146	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	6.21e-10	57	171	20	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	7.31e-10	57	171	21	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	4.06e-15	48	180	59	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9KQ15	2.65e-13	32	186	155	321	Peptidoglycan hydrolase FlgJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=flgJ PE=3 SV=2
Q2G222	2.51e-10	40	238	322	532	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1
Q9X9J3	2.29e-09	39	170	161	301	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
P58231	5.72e-09	57	172	168	292	Peptidoglycan hydrolase FlgJ OS=Escherichia coli O157:H7 OX=83334 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000573	0.998380	0.000410	0.000230	0.000185	0.000173

TMHMM  Annotations     

start	end
10	32