CAZyme Information: MGYG000002565_01527

Basic Information

• Species: Veillonella_A magna
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Veillonellaceae; Veillonella_A; Veillonella_A magna
• CAZyme ID: MGYG000002565_01527
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
386	MGYG000002565_115|CGC1	43789.58	9.4349

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002565	1964232	MAG	China	Asia

• Gene Location: Start: 3946; End: 5106 Strand: -

Full Sequence      

MEGRTKWIVIAYLFAGIGVLAKGPVGIVLPGLLFLVYAGVMRSWRMVRLLFPWQGILVFL
LVAGPWYGYMYHTHGQAFVDGFLGLHNIGRALESEHPADNHWWYYLALFPAASLPWTGAV
IYGMYYGWRQRSDFYLFSIIAGWGTILFYTLMATKYPTYTFISLVPFSFLGAVGIVKLLR
IGADRRLWWILMGPTFFLWGLLAVGSYFVGWGFWYLLYVLVGVGIVLLLACYFNGKRYLL
PAVIGLVTMLIAGVVIYEGVAPLVIRRSSVDYVPAVEAFRGQVYYYDGYSTSLVYYTDRE
VIRINSDYAPEEKRSAVWNGKYKMPIVSEQEAYAQLSKEQALVIVPRRSLKYLQQSPLMG
LFRVYAEEPGVIIFMTGSGLVTMGDN

Enzyme Prediction     

No EC number prediction in MGYG000002565_01527.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	4	348	2.9e-46	0.6759259259259259

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	9.26e-17	2	230	158	398	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	3.26e-12	7	260	166	432	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SNV75245.1	2.58e-126	4	367	157	527
BBU37212.1	1.61e-124	1	358	154	518
QQB17174.1	1.50e-122	1	358	154	518
SNV02078.1	1.50e-122	1	358	154	518
ACZ25367.1	1.50e-122	1	358	154	518

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	9.07e-11	1	118	185	301	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B4TBG8	1.53e-10	16	172	174	327	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Salmonella heidelberg (strain SL476) OX=454169 GN=arnT PE=3 SV=1
Q02R27	1.13e-09	7	182	165	338	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) OX=208963 GN=arnT PE=3 SV=1
Q9HY61	1.99e-09	13	182	170	338	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=arnT PE=3 SV=1
A6V1N8	3.52e-09	13	180	170	336	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain PA7) OX=381754 GN=arnT PE=3 SV=1
A9MJC5	4.67e-09	3	172	161	327	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) OX=41514 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
15	37
49	71
105	127
134	153
158	180
187	209
213	235
242	264