CAZyme Information: MGYG000002566_01845

Basic Information

• Species: Collinsella sp900550835
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp900550835
• CAZyme ID: MGYG000002566_01845
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
306		34560.57	4.3247

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002566	2080428	MAG	China	Asia

• Gene Location: Start: 5; End: 925 Strand: +

Full Sequence      

MKYWLPFNEINMILPLPFMGAGLVFEEGENKEAVEYLAAHNELVASAWATKIAHEIDPEV
KIGCMLAAGSYYPYSCRPGDVRQAQLDNQDNYFFVDVQSRGYYPAYAVKKLERLGIDVGM
TDEDREILAENTVDFISFSYYSTRCSAGADNPDVERTQGNAFAGAKNPYLQESQWGWAID
PLGFRITLNDLYDRYQKPLFVVENGLGAKDVVEEDGSINDDYRIDYLRQHIAAMRDAVTE
DGIDLLGYTTWGPIDLVSAGTGEMSKRYGFIYVDRDDAGNGTLKRSKKKSFDWYKHVIET
NGEDLS

Enzyme Prediction     

EC	3.2.1.86	3.2.1.21	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	302	3.5e-77	0.627039627039627

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09593	arb	0.0	1	306	174	478	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	1.06e-170	1	306	172	474	cryptic 6-phospho-beta-glucosidase; Provisional
PRK09589	celA	5.28e-139	1	305	168	476	6-phospho-beta-glucosidase; Reviewed
COG2723	BglB	1.50e-130	2	306	161	458	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK15014	PRK15014	1.27e-118	1	305	170	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZH68819.1	1.14e-222	2	306	172	476
ATP54514.1	1.26e-205	2	306	172	476
QWT17213.1	8.59e-180	2	305	172	474
AEB07701.1	3.20e-170	2	306	172	475
QIA32972.1	5.57e-164	2	305	172	475

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	1.48e-131	2	305	168	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
2XHY_A	8.93e-112	2	305	173	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F66_A	1.53e-107	2	305	172	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	4.34e-107	2	305	172	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3PN8_A	4.47e-104	2	305	172	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P24240	2.07e-137	2	305	173	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
P40740	2.44e-127	2	305	168	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q48409	1.83e-115	2	305	165	462	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1
Q46829	4.89e-111	2	305	173	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P11988	4.82e-109	4	305	167	462	6-phospho-beta-glucosidase BglB OS=Escherichia coli (strain K12) OX=83333 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.996496	0.003496	0.000031	0.000004	0.000003	0.000004

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002566_01845.