CAZyme Information: MGYG000002568_00022

Basic Information

• Species: Phocaeicola sp900542985
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900542985
• CAZyme ID: MGYG000002568_00022
• CAZy Family: GH27
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
538		60225.77	5.9992

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002568	2891879	MAG	China	Asia

• Gene Location: Start: 22061; End: 23677 Strand: +

Full Sequence      

MKKIRLISSCCRAVCGIGLAFMPVLVQAQQVETPLMGWSSWNTYRVNINEELIRKQADAM
AASGLKEVGYRFINIDDGFFGYRDETGRLHTHPQRFPNGMKGIVDYIHSLGFKAGTYSDA
GSNTCGSIWDNDVNGINVGLYGHERQDADLMFNEWGFDFIKIDYCGAGQELALEEQKRYT
EICKAIEEVACHKVSVNICRWAYPGTWVKEIARSWRISSDITPNWWSVRDIIRKNLYLSA
YAGGGHYNDMDMLEIGRGLKPEEEEVHFGMWCIMSSSLLIGCDMTTIPAASLELLKNKEL
IALNQDPLGLQAYVVQHEGNGYVLVKDIEQKRGTARAVALYNPSDTLCHFSVPASVLELG
GKLKVRDLVKRRSEGTLKGVLVYTLPAHSVKILRVEGETRLEPTVYEAEWAYLPCFNDLA
KHPKTVAYTPVEGASEGMTVSYVGGSTENYAEWSEVYSEKGGQYEMTVSYVPGKYRKLEV
EVNGKKTLLTDLETDTEKGISRITLPVTLNAGYNVVRMGSAYCWAPDIDCFTLCRIGK

Enzyme Prediction     

EC	3.2.1.22

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH27	139	373	1.6e-65	0.9737991266375546

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14792	GH27	5.25e-118	34	306	1	271	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
PLN02808	PLN02808	2.24e-81	33	392	31	380	alpha-galactosidase
PLN02229	PLN02229	5.46e-80	33	370	62	391	alpha-galactosidase
PLN02692	PLN02692	7.44e-72	33	392	55	405	alpha-galactosidase
pfam16499	Melibiase_2	2.58e-60	33	306	1	284	Alpha galactosidase A.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJR69910.1	3.52e-283	32	538	27	535
QJR74242.1	3.52e-283	32	538	27	535
QJR61495.1	3.52e-283	32	538	27	535
QJR65648.1	3.52e-283	32	538	27	535
ALA72653.1	3.52e-283	32	538	27	535

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1UAS_A	1.09e-68	33	368	8	333	ChainA, alpha-galactosidase [Oryza sativa]
6F4C_B	5.32e-65	33	392	8	357	Nicotianabenthamiana alpha-galactosidase [Nicotiana benthamiana]
3A21_A	1.29e-64	26	472	2	445	CrystalStructure of Streptomyces avermitilis beta-L-Arabinopyranosidase [Streptomyces avermitilis],3A21_B Crystal Structure of Streptomyces avermitilis beta-L-Arabinopyranosidase [Streptomyces avermitilis],3A22_A Crystal Structure of beta-L-Arabinopyranosidase complexed with L-arabinose [Streptomyces avermitilis],3A22_B Crystal Structure of beta-L-Arabinopyranosidase complexed with L-arabinose [Streptomyces avermitilis],3A23_A Crystal Structure of beta-L-Arabinopyranosidase complexed with D-galactose [Streptomyces avermitilis],3A23_B Crystal Structure of beta-L-Arabinopyranosidase complexed with D-galactose [Streptomyces avermitilis]
3A5V_A	9.15e-59	33	394	8	389	Crystalstructure of alpha-galactosidase I from Mortierella vinacea [Umbelopsis vinacea]
4OGZ_A	8.22e-55	33	312	99	392	Crystalstructure of a putative alpha-galactosidase/melibiase (BF4189) from Bacteroides fragilis NCTC 9343 at 2.00 A resolution [Bacteroides fragilis NCTC 9343],4OGZ_B Crystal structure of a putative alpha-galactosidase/melibiase (BF4189) from Bacteroides fragilis NCTC 9343 at 2.00 A resolution [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B3PGJ1	1.41e-76	16	395	8	401	Alpha-galactosidase A OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=agaA PE=1 SV=1
Q8RX86	2.15e-72	33	392	39	388	Alpha-galactosidase 2 OS=Arabidopsis thaliana OX=3702 GN=AGAL2 PE=1 SV=1
Q8VXZ7	9.29e-72	33	368	72	399	Alpha-galactosidase 3 OS=Arabidopsis thaliana OX=3702 GN=AGAL3 PE=1 SV=1
Q55B10	1.07e-68	33	376	27	360	Probable alpha-galactosidase OS=Dictyostelium discoideum OX=44689 GN=melA PE=3 SV=1
P14749	2.18e-68	32	392	54	404	Alpha-galactosidase OS=Cyamopsis tetragonoloba OX=3832 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000397	0.998719	0.000371	0.000173	0.000161	0.000151

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002568_00022.