CAZyme Information: MGYG000002568_00117

Basic Information

• Species: Phocaeicola sp900542985
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900542985
• CAZyme ID: MGYG000002568_00117
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
258	MGYG000002568_1|CGC4	29096.91	8.4514

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002568	2891879	MAG	China	Asia

• Gene Location: Start: 129291; End: 130067 Strand: +

Full Sequence      

MKRNFILTVCFLLSLCVNAQDKMGEFEKKVYVSEAGDTLRYRLLLPENYDENKCYPLVLF
LHGAGERGCDNEKQLFHGGQMWLNPVNRENYPAFVLAPQCPDSCYWAYGTRPVSFVPEEM
PLSTDDVQIIKLLKGLLDSYLSLPQVDKKKVYVMGLSMGGMATFDLVSRYPDVFAAAIPI
CGIVNPSRLAVAKKVKFRIFHGDADNVVPVIGSRAAYKALKKAGAKVEYIEFPGCGHASW
HPAFNYPDFMKWLFSQKK

Enzyme Prediction     

No EC number prediction in MGYG000002568_00117.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	36	238	3.1e-30	0.8942731277533039

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4099	COG4099	4.40e-47	29	257	164	386	Predicted peptidase [General function prediction only].
COG1506	DAP2	1.17e-22	19	237	358	594	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
COG0400	YpfH	5.29e-15	56	238	19	189	Predicted esterase [General function prediction only].
COG3509	LpqC	3.27e-12	35	209	43	205	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
pfam01738	DLH	5.28e-12	124	238	71	186	Dienelactone hydrolase family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI61582.1	9.97e-50	26	257	811	1042
ABS60377.1	2.73e-49	23	258	7	245
QDU56037.1	2.16e-36	21	258	781	1007
QJW99051.1	1.08e-33	25	258	33	240
VTR91196.1	2.86e-32	25	258	32	239

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DOH_A	2.08e-49	34	258	153	380	CrystalStructure of a Thermostable Esterase [Thermotoga maritima],3DOH_B Crystal Structure of a Thermostable Esterase [Thermotoga maritima],3DOI_A Crystal Structure of a Thermostable Esterase complex with paraoxon [Thermotoga maritima],3DOI_B Crystal Structure of a Thermostable Esterase complex with paraoxon [Thermotoga maritima]
3WYD_A	3.00e-29	36	258	18	217	C-terminalesterase domain of LC-Est1 [uncultured organism],3WYD_B C-terminal esterase domain of LC-Est1 [uncultured organism]
5DWD_A	3.31e-11	57	237	43	222	Crystalstructure of esterase PE8 [Pelagibacterium halotolerans B2],5DWD_B Crystal structure of esterase PE8 [Pelagibacterium halotolerans B2]
4Q1V_A	2.93e-07	39	178	473	602	Crystalstructure of a putative dipeptidyl aminopeptidase IV (BACOVA_01349) from Bacteroides ovatus ATCC 8483 at 2.48 A resolution [Bacteroides ovatus ATCC 8483],4Q1V_B Crystal structure of a putative dipeptidyl aminopeptidase IV (BACOVA_01349) from Bacteroides ovatus ATCC 8483 at 2.48 A resolution [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001079	0.774839	0.223129	0.000409	0.000277	0.000241

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002568_00117.