CAZyme Information: MGYG000002568_00335

Basic Information

• Species: Phocaeicola sp900542985
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900542985
• CAZyme ID: MGYG000002568_00335
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
932		106143.2	5.6543

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002568	2891879	MAG	China	Asia

• Gene Location: Start: 31514; End: 34312 Strand: -

Full Sequence      

MNLIYSIMKNLFVLLSCICCFSCKPSIQQIDLSGTWEFTTDTSQWNQSLILPGSVTSNRL
GEDISMSTPWTGTIVDSSFFFADKYAEYRTTENFKVPFWLQPEKYFWGEAWYKKTVEIPQ
NWDKYDVMLTLERCHWDTELWIDGNYAGSGHSLGAPHRYLLTQWLTPGKHELLLKVDNSL
KTVNPGINSHSVTDHTQGNWNGVIGKIALEALPQIRINHLDIFPDIDHKKVKVELEALNS
TSTAQEVTFKMEVDGRAFEKSQTLPTGTSPVYAEIEMGDSILLWDEFHPHLYQLNVHLSG
TDGKELSHCSEQFGMRKLEVVQNHILINGRKVFFRGMLDCAAFPLTDYPSMDKEYWVKMF
TNCRNHGLNHVRFHSWCPPEIAFQVADEMGFYLQIECSSWANQGITIGDGTSLDQFIRDE
SERMVREYGNHPSFCMMLYGNEPSGEKSTPYLADFVTHWKEKDTRRLYSTAAGWPNLPIN
DFLNDPTPRIQGWGQGLTSIINAEAPRTNYDWSNYVQQFNQPVISHEIGQWCVYPDFKEI
SKYTGLMKAHNFEIFRDDLKKNGMIHLADSFLLASGKLQALCYKADIEAALRTPDFGGFQ
LLGLYDFPGQGTALVGVLNVFGEEKGYISPEEYRQFCNTTVPLARLPKLIYTNNESLTAS
VEVAHFGDKQLSNPKLGWILSTDDGKTIGKGQWNANQISIGNNIPLGNINFPLSGITEPK
QLSLKVYVNDFENEWHIWGYPSTPRNQYTDNDILVTNSLDNKAKEVLEKGGKVLLSLPKG
KLRADMGGDIQIGFSSIFWNTAWTLGQAPHTLGILCNPHHPALSQFPTNYYSDYQWWDAM
SYSNAIEMDKLAKGAQPIVRVIDDWFTNRSLGLITEFKVGKGKLVLSGIDFWQKMDERPA
ARQLLNSLKTYMSSEQFHPVQEIKTEDLQQLY

Enzyme Prediction     

No EC number prediction in MGYG000002568_00335.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	26	484	1.1e-68	0.48936170212765956

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.19e-22	25	490	8	463	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	8.31e-14	31	336	14	296	beta-D-glucuronidase; Provisional
pfam00703	Glyco_hydro_2	3.63e-10	215	316	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10340	ebgA	2.85e-08	112	442	113	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02836	Glyco_hydro_2_C	2.44e-05	319	467	2	157	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTO24394.1	0.0	22	931	15	924
QCQ36726.1	0.0	22	931	15	924
AUI46175.1	0.0	22	931	15	924
QKH84202.1	0.0	22	931	15	924
AKA51553.1	0.0	22	931	15	924

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6S6Z_A	9.69e-18	112	467	113	462	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	9.70e-18	112	467	114	463	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
6D89_A	3.57e-13	101	559	91	525	Bacteroidesuniformis beta-glucuronidase 1 with N-terminal loop deletion [Bacteroides uniformis],6D89_B Bacteroides uniformis beta-glucuronidase 1 with N-terminal loop deletion [Bacteroides uniformis],6D89_C Bacteroides uniformis beta-glucuronidase 1 with N-terminal loop deletion [Bacteroides uniformis],6D89_D Bacteroides uniformis beta-glucuronidase 1 with N-terminal loop deletion [Bacteroides uniformis]
6D1N_A	3.62e-13	101	559	99	533	Apostructure of Bacteroides uniformis Beta-glucuronidase 1 [Bacteroides uniformis],6D1N_B Apo structure of Bacteroides uniformis Beta-glucuronidase 1 [Bacteroides uniformis],6D41_A Bacteriodes uniformis beta-glucuronidase 1 bound to D-glucaro-1,5-lactone [Bacteroides uniformis],6D41_B Bacteriodes uniformis beta-glucuronidase 1 bound to D-glucaro-1,5-lactone [Bacteroides uniformis],6D6W_A Bacteroides uniformis beta-glucuronidase 1 bound to glucuronate [Bacteroides uniformis],6D6W_B Bacteroides uniformis beta-glucuronidase 1 bound to glucuronate [Bacteroides uniformis],6D6W_C Bacteroides uniformis beta-glucuronidase 1 bound to glucuronate [Bacteroides uniformis],6D6W_D Bacteroides uniformis beta-glucuronidase 1 bound to glucuronate [Bacteroides uniformis],6D7F_A Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_B Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_C Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_D Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_E Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_F Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis]
6ZJV_A	1.39e-09	140	505	158	503	Cold-adaptedbeta-D-galactosidase from Arthrobacter sp. 32cB mutant D207A [Arthrobacter sp. 32cB],6ZJW_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB mutant D207A in complex with galactose [Arthrobacter sp. 32cB],6ZJX_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB mutant D207A in complex with saccharose [Arthrobacter sp. 32cB]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9K9C6	1.71e-17	112	467	124	482	Beta-galactosidase OS=Alkalihalobacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) OX=272558 GN=lacZ PE=3 SV=1
Q56307	5.31e-17	112	467	114	463	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
Q04F24	9.25e-15	140	491	148	503	Beta-galactosidase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) OX=203123 GN=lacZ PE=3 SV=1
A7MN76	2.77e-14	112	491	134	517	Beta-galactosidase OS=Cronobacter sakazakii (strain ATCC BAA-894) OX=290339 GN=lacZ PE=3 SV=1
A5F5U6	1.25e-12	140	483	149	497	Beta-galactosidase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) OX=345073 GN=lacZ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001501	0.218529	0.779623	0.000099	0.000119	0.000110

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002568_00335.