CAZyme Information: MGYG000002568_00948

Basic Information

• Species: Phocaeicola sp900542985
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900542985
• CAZyme ID: MGYG000002568_00948
• CAZy Family: GT0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
303	MGYG000002568_12|CGC1	34931.62	8.5985

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002568	2891879	MAG	China	Asia

• Gene Location: Start: 633; End: 1544 Strand: -

Full Sequence      

MTYAPILLFVYNRPEHTRRLISSLLQNQEAAESELFIYADQCKDIASAQSVQEVREYIHT
ITGFKRVNLIERTENWGLARNIIDGVTTQVNAYGRVIVLEDDLIVAPYFLRFMNDALEIY
KDESRVGHIQACDFTHAPTLPDTFLIKWTGSWGWATWARAWKHFNPDGTALLQELERKQL
TRTFDFNGTYGFTRMLRRQTEGKNNSWAIRWNASLFLADILSLNVGKSLVQNTGFDGSGT
NCGGGGLYNSTLWMQPLPVSLLSPIEENLEARKEFQKYYYRTNNFWAKAFRRIRRTLKGD
FGA

Enzyme Prediction     

No EC number prediction in MGYG000002568_00948.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00535	Glycos_transf_2	1.70e-06	10	111	6	97	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd02514	GT13_GLCNAC-TI	2.68e-05	4	113	2	118	GT13_GLCNAC-TI is involved in an essential step in the synthesis of complex or hybrid-type N-linked oligosaccharides. Alpha-1,3-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase (GLCNAC-T I , GNT-I) transfers N-acetyl-D-glucosamine from UDP to high-mannose glycoprotein N-oligosaccharide, an essential step in the synthesis of complex or hybrid-type N-linked oligosaccharides. The enzyme is an integral membrane protein localized to the Golgi apparatus. The catalytic domain is located at the C-terminus. These proteins are members of the glycosy transferase family 13.
pfam03071	GNT-I	3.44e-05	1	166	92	271	GNT-I family. Alpha-1,3-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase (GNT-I, GLCNAC-T I) EC:2.4.1.101 transfers N-acetyl-D-glucosamine from UDP to high-mannose glycoprotein N-oligosaccharide. This is an essential step in the synthesis of complex or hybrid-type N-linked oligosaccharides. The enzyme is an integral membrane protein localized to the Golgi apparatus, and is probably distributed in all tissues. The catalytic domain is located at the C-terminus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY36898.1	1.03e-178	3	303	2	302
ANV98023.1	2.70e-86	4	238	7	244
ABZ94462.1	3.13e-80	1	279	1	279
ABZ98117.1	3.13e-80	1	279	1	279
ATY34291.1	3.88e-76	4	268	6	269

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002568_00948.