CAZyme Information: MGYG000002568_01016

Basic Information

• Species: Phocaeicola sp900542985
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900542985
• CAZyme ID: MGYG000002568_01016
• CAZy Family: GH3
• CAZyme Description: Xylan 1,4-beta-xylosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
883		98506.36	6.0058

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002568	2891879	MAG	China	Asia

• Gene Location: Start: 9849; End: 12500 Strand: -

Full Sequence      

MKKAIILACGILWGCTITMQAEDLPYKNPKLSVEERVEDLLKRMTVEEKFWQIYMMPGDL
DAGKERFKDGIFGFQVATVGSSDPQMRQMLQYNPKMTAAETVKKVNRIQRYFVEETRLGI
PAIIFDEALHGLVRGGATAFPQSIALAATFDTTLVSRVSTAIARETKSRGIRQILSPVVN
LATDVRWGRVEETYGEDPCLSADMGVSFVKNFERMGVITTPKHFAVNSGDGGRDSNPIHY
TERFLEETHLVPFKACFQQGGSQSVMTAYNMIDGTPCTANSWLTIDKLRKEWGFDGFTIA
DADAVGIIHKLHHTINNWEEAGATAVNNGLDVIFQTTYEEHEPFLEACRKGLITEEALNR
AVRQVLKAKFRLGLFENPYMDESEADRWNACAEHRALAQEAAARSMVLLKNENQLLPLSR
DLKRIAVIGQDAAEARLGGYSGPGVNKISIVEGLKKELAGKTEVVYEEGCKRMNPQWLTI
PENCLSQEDGTSGLVASYFKNIRWEGTPALKRNDKAVQFSWTLFAPDPCLAVDWFSVEWN
GKLKSPVSGDYQIGLEGNDGYQLWIDGKKVIDRPEKASFRTEVVPFRLEKGKEYAVKVRF
YENTRNARIRLVWNVGVQNEDASIEKAVRAAASADVAVVVAGIEEGEFRDRGYLTLPGRQ
EELIKRVAATGKPVVVVLVGGSAVVMSEWLDKVPAVLNAWYPGEAGGAAVADVLMGDANP
SGKLPITYPIDEAQLPLNYSHKPTGRSDDYLNLTGEPLFPFGYGLSYTEFEYNNLKVQPS
GKHTYNVSFTIRNVGKYKGYEVPQLYLRDKVASVTQPITRLIHYAAIELNPGEEKTVSFI
VNEHDLSMLDKSMNRVVEPGDFRLMIGRSCKDIRLQEVINVKE

Enzyme Prediction     

No EC number prediction in MGYG000002568_01016.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	114	333	1.4e-67	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	3.95e-143	1	877	1	761	beta-glucosidase BglX.
COG1472	BglX	2.17e-93	44	441	1	372	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	7.97e-78	117	867	78	769	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	2.81e-61	45	368	1	316	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	9.24e-49	406	767	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT53542.1	0.0	1	798	59	857
AFD07788.1	0.0	6	881	17	895
QKJ63409.1	0.0	1	883	1	889
AOW10295.1	0.0	1	883	1	889
QNA43071.1	0.0	1	882	1	895

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z87_A	1.26e-111	20	874	31	778	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5TF0_A	3.67e-104	37	874	13	744	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
5XXL_A	1.72e-103	27	874	5	745	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	9.08e-103	27	874	5	745	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5Z9S_A	3.04e-99	21	871	12	776	Functionaland Structural Characterization of a beta-Glucosidase Involved in Saponin Metabolism from Intestinal Bacteria [Bifidobacterium longum],5Z9S_B Functional and Structural Characterization of a beta-Glucosidase Involved in Saponin Metabolism from Intestinal Bacteria [Bifidobacterium longum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56078	2.88e-102	9	867	5	751	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
T2KMH0	1.11e-100	117	878	62	718	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
D5EY15	2.47e-100	1	878	1	857	Xylan 1,4-beta-xylosidase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyl3A PE=1 SV=1
Q5BFG8	9.17e-100	119	873	42	830	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
P33363	4.32e-98	9	877	5	761	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000479	0.686425	0.312326	0.000276	0.000257	0.000222

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002568_01016.