CAZyme Information: MGYG000002571_00046

Basic Information

• Species: UBA1234 sp900765095
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; UBA1234; UBA1234; UBA1234 sp900765095
• CAZyme ID: MGYG000002571_00046
• CAZy Family: GT2
• CAZyme Description: Beta-monoglucosyldiacylglycerol synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
409	MGYG000002571_1|CGC3	47969.14	8.1247

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002571	1451024	MAG	China	Asia

• Gene Location: Start: 46960; End: 48189 Strand: +

Full Sequence      

MKFDAILLTVQVIFFYILMFFWVYQLFICMFAFINEKKKKEIIQKNHKFMAVISARNEEN
VIANLIESIKEQTYKYIDIYVIADNCDDTTAEVARLHGATVYERFDENKKSKGFALEWFF
EKILLEKSNEYDAFCIFDADNIVSKDFFETMNTKLCQGEKIVQGYRDISNAGDTWVSANY
AIFYWTMNRCYHYARYKLGLSPLINGTGFMVSMDIIKEKNGWHSDTLTEDIEFSIENIIK
NQKIGWAQDAVVYDEQPLKFKQSFRQRLRWSVGHLQCFQKFFCEFLKLNKFNATTIDTLI
YTLGMPMILFSIIITIIDIIKVLFIKQFNYTTLIGGLKFTALTMLISMLQALLITIIEKK
SVKKVWKGIATYPIFLVSWFVINVMAFFNKNLEWKPITHLGSKDINETS

Enzyme Prediction     

No EC number prediction in MGYG000002571_00046.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	49	273	1.1e-24	0.9826086956521739

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06438	EpsO_like	1.47e-78	52	233	2	183	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.
cd06423	CESA_like	1.24e-41	52	230	2	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	4.69e-35	12	382	15	388	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
pfam13641	Glyco_tranf_2_3	6.36e-19	49	271	4	228	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd00761	Glyco_tranf_GTA_type	3.90e-14	51	162	1	109	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWT55360.1	1.07e-107	24	405	24	410
BCI60981.1	1.16e-102	21	407	22	412
ADG00238.1	1.09e-96	16	407	17	419
ABS41381.1	1.09e-96	16	407	17	419
AUN03940.1	1.54e-96	16	407	17	419

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96587	7.38e-15	35	290	37	296	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999764	0.000239	0.000008	0.000001	0.000001	0.000051

TMHMM  Annotations     

start	end
12	34
303	325
332	354
369	388