CAZyme Information: MGYG000002571_00139

Basic Information

• Species: UBA1234 sp900765095
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; UBA1234; UBA1234; UBA1234 sp900765095
• CAZyme ID: MGYG000002571_00139
• CAZy Family: GH18
• CAZyme Description: Spore germination protein YaaH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
426		48147.6	5.4939

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002571	1451024	MAG	China	Asia

• Gene Location: Start: 126001; End: 127281 Strand: -

Full Sequence      

MIIYVVKNGDSLYKISKIYGVSVDEISYVNMLETPDKLVIGQSLIIPIKSYTHIVQRGES
IYGISRYYNVSIDDILKLNPNITNPGNILPGEVLNIPGDNRNRKTIDVNGYAYANISDST
LDSSLPYLTYIAPFSYQVQGDGSLARLQDNNILSKAFSTNTVPLLVITNIKSTGGFDSEL
AKTILTNPNIQNELLDNIKTELETKGFGGINIDFEYIYPENRDDYNSFLQRVADRFKPMG
YLILTSLAPKTSKNQQGTLYEAHDYDFHGSVADKVIIMTYEWGYTYSSPMAIAPINEVRK
VLDYAVSAIPCRKILMGLSNYGYDWKIPYQKGVPARAISNLNALNLAVKNNSTINFDNVA
SAPYFNYVDNEGKQHVVWFEDARSYNERLKLISEYNLGGTSIWTINNLFRPLFEILESQY
IVYKRN

Enzyme Prediction     

No EC number prediction in MGYG000002571_00139.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	91	406	1.8e-37	0.8614864864864865

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	7.02e-132	106	405	2	302	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	3.96e-115	1	420	1	422	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
cd06549	GH18_trifunctional	3.48e-30	156	403	54	288	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
smart00636	Glyco_18	2.98e-23	122	406	20	332	Glyco_18 domain.
cd02876	GH18_SI-CLP	9.15e-19	175	405	77	307	Stabilin-1 interacting chitinase-like protein (SI-CLP) is a eukaryotic chitinase-like protein of unknown function that interacts with the endocytic/sorting transmembrane receptor stabilin-1 and is secreted from the lysosome. SI-CLP has a glycosyl hydrolase family 18 (GH18) domain but lacks a chitin-binding domain. The catalytic amino acids of the GH18 domain are not conserved in SI-CLP, similar to the chitolectins YKL-39, YKL-40, and YM1/2. Human SI-CLP is sorted to late endosomes and secretory lysosomes in alternatively activated macrophages.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGU95872.1	1.02e-144	1	424	1	423
AEB75367.1	8.22e-139	1	424	1	423
AOZ77090.1	2.42e-138	1	424	1	424
AOZ80887.1	2.42e-138	1	424	1	424
AJA53944.1	2.42e-138	1	424	1	424

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4S3J_A	2.44e-85	3	425	5	430	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]
4S3K_A	8.26e-84	3	425	6	432	ChainA, Spore germination protein YaaH [Priestia megaterium QM B1551]
3CZ8_A	2.48e-62	126	405	31	308	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
5JH8_A	5.15e-24	167	405	67	299	Crystalstructure of chitinase from Chromobacterium violaceum ATCC 12472 [Chromobacterium violaceum ATCC 12472]
4WIW_A	5.41e-23	127	417	33	345	ChainA, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_B Chain B, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_C Chain C, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_D Chain D, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_E Chain E, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_F Chain F, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37531	4.13e-89	1	425	1	428	Cortical fragment-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleL PE=1 SV=2
P0DPJ9	6.16e-85	3	425	4	429	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1
Q9K3E4	1.07e-82	3	425	4	429	Cortical fragment-lytic enzyme OS=Bacillus cereus OX=1396 GN=sleL PE=1 SV=1
O05495	4.24e-72	1	411	1	406	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
O32258	3.99e-30	127	407	51	330	Uncharacterized glycosylase YvbX OS=Bacillus subtilis (strain 168) OX=224308 GN=yvbX PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002571_00139.