CAZyme Information: MGYG000002573_00446

Basic Information

• Species: Ruminococcus_C sp900545285
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus_C; Ruminococcus_C sp900545285
• CAZyme ID: MGYG000002573_00446
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
764	MGYG000002573_7|CGC2	84130.46	4.7614

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002573	2234911	MAG	China	Asia

• Gene Location: Start: 39820; End: 42114 Strand: +

Full Sequence      

MNIPEIVSQLTLEEKASLCSGGDFWHTKAIERLGIPAMMMCDGPHGLRKQNLVSDNMGIN
DSIPAVCFPAGCATASSFDRALVRQMGEALGNECQAEDVGVILGPAVNIKRSPLCGRNFE
YYSEDPYVASQMASSFIQGVQSQNVGTSIKHFYANNQEHRRMSSSSELDERTAREIYLSA
FETAIREAKPWTVMCSYNRINGVYAAENRRALTDVLRGEWGFDGFVVSDWGAVNDRVPDL
EAGMDLEMPASGGFRDEEIITAVRVGRMPEAVLDQAVTRILTIVDRYLRGRNPKAVFDRD
KDHALAREIAGQCMVLLKNEDQLLPLKRTQKAAFIGAFAEKPRYQGGGSSHINSFKVESA
LEMAKDCCVTYAKGFAAESELVDEALLAEAVEAAAEADVAVVFAGLPDSFESEGFDRKHM
ELPLCQNVLISAVAKANPNTVVVLHNGAPVEMPWISEVKGILETYLCGQAVGGAVIDVLY
GEVNPSGHLAETFPRALRETPSYISFQGEGDRVEYREGVFVGYRYYATKKIPVLFPFGHG
LSYTTFAFSNLRTNQVVYHRGDRVEVSVDVTNTGDRYGKEVVQLYIMPQIETDAILRPVL
ELRGFEKVGLKSGETKTVHFTLDRRAFSSYNIQRQKWMAERGDYIIACGDSSENLPMQQT
VHIEGDLPIPKCITMDTTFGDVLRIPGAANLVTPFAAVFGATNESADENAMGESTAEMME
AMMQYMPIRGLISFGGGTVTTRQCEELIQKLNVLAEAAEQKYES

Enzyme Prediction     

EC	3.2.1.21	3.2.1.37	3.2.1.23	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	28	249	1e-71	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	9.97e-97	32	651	101	754	beta-glucosidase BglX.
COG1472	BglX	1.34e-76	22	350	47	372	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	1.06e-59	6	658	56	778	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	6.30e-55	314	543	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	1.64e-42	32	283	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNO18561.1	0.0	1	754	1	758
QUC66582.1	6.79e-315	1	752	1	753
QUA52387.1	5.53e-314	1	752	1	753
QUI21624.1	1.20e-311	3	752	2	754
QHQ63232.1	3.31e-311	3	752	6	754

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	1.17e-277	1	752	3	752	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	8.06e-206	7	759	9	751	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
3AC0_A	1.86e-130	2	667	5	840	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	8.85e-127	2	667	5	840	Crystalstructure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
2X40_A	1.98e-122	3	663	4	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	4.50e-277	1	752	3	752	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	4.53e-195	7	731	9	733	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	4.07e-193	7	731	9	733	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
Q2U8Y5	3.95e-136	1	655	4	823	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
B8NDE2	5.56e-136	1	655	4	823	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.996109	0.003835	0.000072	0.000007	0.000004	0.000010

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002573_00446.