CAZyme Information: MGYG000002573_01476

Basic Information

• Species: Ruminococcus_C sp900545285
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus_C; Ruminococcus_C sp900545285
• CAZyme ID: MGYG000002573_01476
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
476	MGYG000002573_40|CGC1	54510.26	4.6587

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002573	2234911	MAG	China	Asia

• Gene Location: Start: 15542; End: 16972 Strand: +

Full Sequence      

MNIRTQNLLCACQKLEGIQNKSDPWRPEFHVSPPVGWMNDPNGLCQIGDTHHLFFQYSPF
DTKPGLNYWGHFSTRDFVHYTYQEPALCSDEQFDCHGVYSGSVLVENGQPLAFYTGNVKK
VGAYDYVEEGREHNTILAQGWDGCHFHQKTLLLRNEDYPENVTCHVRDPKVWKEQDTYCM
VLGARRKDDVGEVLFYQSTDLLHWELKNSLVTEKPLGYMWECPDYFVLDGVSVLTFSPQG
VPADGFRFQNIYQSGYCVLHGEIGGDYTLSEFRELDAGFDFYAPQTYQDEQGRRILIGWL
GMPDSDYGYAEKAYGWTQMQTIPRVLSVRDGALYQQPLPELQALRRSAFRIQVEESSEMR
CAPAYETDIRVEEGDHLTLRFGTDGVLEWKDGMVTLSFGESGLGRTSRTVPLEQLKRIQL
FCDTSSIEIFLNDGAAVFTSRFYADPVASVFSVAVQKAEFIMWELQPISIRKENLL

Enzyme Prediction     

EC	3.2.1.26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	30	337	2.9e-88	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd18623	GH32_ScrB-like	2.49e-150	36	330	1	289	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
TIGR01322	scrB_fam	7.52e-142	22	445	10	445	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1621	SacC	1.02e-129	23	467	26	486	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
pfam00251	Glyco_hydro_32N	4.35e-103	30	337	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.
smart00640	Glyco_32	7.51e-98	30	434	1	437	Glycosyl hydrolases family 32.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CED94068.1	4.05e-156	1	470	4	480
QEH67471.1	1.07e-153	13	465	16	474
ADZ81804.1	4.92e-152	13	465	16	474
QCU01937.1	4.00e-144	26	466	29	470
CBL20909.1	6.47e-143	26	459	29	461

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VCO_A	2.49e-77	27	443	27	458	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
7BWB_A	1.93e-65	3	445	22	462	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	2.84e-64	3	445	22	462	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
6NU7_A	1.28e-60	19	444	26	463	Structureof sucrose-6-phosphate hydrolase from Lactobacillus gasseri [Lactobacillus gasseri 224-1],6NU8_A Structure of sucrose-6-phosphate hydrolase from Lactobacillus gasseri in complex with fructose [Lactobacillus gasseri 224-1]
1UYP_A	2.57e-51	25	468	2	430	Thethree-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_B The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_C The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_D The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_E The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_F The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07819	1.59e-103	13	446	17	456	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2
P13394	2.19e-95	18	458	29	468	Sucrose-6-phosphate hydrolase OS=Vibrio alginolyticus OX=663 GN=scrB PE=2 SV=1
P40714	4.12e-83	5	446	2	452	Sucrose-6-phosphate hydrolase OS=Escherichia coli OX=562 GN=cscA PE=3 SV=1
Q05936	6.52e-83	13	459	22	479	Sucrose-6-phosphate hydrolase OS=Staphylococcus xylosus OX=1288 GN=scrB PE=3 SV=1
P16553	8.69e-82	6	462	3	467	Raffinose invertase OS=Escherichia coli OX=562 GN=rafD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002573_01476.