CAZyme Information: MGYG000002575_00377

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae
• CAZyme ID: MGYG000002575_00377
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
395	MGYG000002575_18|CGC1	45548.26	8.723

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002575	2444047	MAG	China	Asia

• Gene Location: Start: 8205; End: 9392 Strand: +

Full Sequence      

MYGEAWQSGMCLRQLNFSNPKQIMKKNTWIIWLLLAAFCMPSQAQVTFRKEEVKSIMQRV
ADWQMDNFKPKREYGELDWTNGALYIGMMDWAELAERLDGTDRYYQWLVKLGKRNHWKMN
KRMYHADDITVGQCFIELYRKYKDEAMIAPVIERADYVVSHPSDGTFKLNYGNARSLERW
TWCDALFMAPPVYAKLYTLTGDKKYLKFMNTEFRATYDSLYDKGAKLFYRDWRYIGKQEA
NGKKVFWGRGNGWVIAGLADILKELPAKNKKDRKSYEELFRELSHSLATLQCEDGYWHAS
LLDPASYPSPETSATGFIVYGLAYGVNAGLLDRATYLPVIEKGWKALTDAVNEEGKLGYV
QPIGADPQKVTKDMTSSYGVGAFLAAGCEIYKMAQ

Enzyme Prediction     

No EC number prediction in MGYG000002575_00377.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	71	392	2e-88	0.9789156626506024

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.31e-102	56	393	1	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	1.34e-60	42	361	5	314	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU93222.1	4.35e-183	24	395	1	370
QGT72377.1	1.76e-182	24	395	1	370
QDH53356.1	1.67e-180	33	395	11	370
QUT26116.1	1.67e-180	33	395	11	370
QDM10174.1	1.67e-180	33	395	11	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CE7_A	1.51e-73	41	393	17	369	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
5NOA_A	7.36e-67	37	389	17	370	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	7.36e-56	47	395	10	359	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
1NC5_A	7.99e-13	127	390	88	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	3.26e-12	127	390	78	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL9	2.31e-74	33	395	14	377	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
L7P9J4	1.01e-72	41	393	24	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
P9WF04	8.48e-71	54	390	58	408	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O34559	4.38e-12	127	390	88	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.093235	0.900693	0.005260	0.000320	0.000236	0.000254

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002575_00377.