CAZyme Information: MGYG000002575_00919

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae
• CAZyme ID: MGYG000002575_00919
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
391	MGYG000002575_62|CGC1	44749.11	8.5126

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002575	2444047	MAG	China	Asia

• Gene Location: Start: 7021; End: 8196 Strand: +

Full Sequence      

MKYFLIVGEASGDLHASHLMQALRNVDPDAEFHFYGGDLMSAVGGVRLKHYKEMAYMGFV
TVLLHLPHILRNMQRCKKAIRAWNPDVVILVDYPGFNLRIAEYVHRKTNIPVYYYISPKI
WAWKEFRIKKIRQYVDEMFSIFPFEIDFFEKKHHYPVHYVGNPTVDEIEGFRASNEESFQ
NFVKANGLVSGRPIIALLAGSRKQEIKDNLPIMCQAAKPIVEKGYQLVLAGAPNIDPSFY
KKYLSCGTELDDVPVTVVRGMTYRLLQQAEAALVTSGTATLETALFRVPQVVCYHLPFGR
FYSLLRRWFLKVPYISLVNLVSEREVVCELVAEEMTVNSVRRCLTDILEGGARRQQMLAD
YERMIAILGPTGAAERTAEKMVCLLKEGYQN

Enzyme Prediction     

No EC number prediction in MGYG000002575_00919.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	366	5.9e-114	0.9830508474576272

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	2.50e-113	1	386	2	376	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.83e-100	1	387	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	3.93e-75	4	354	2	345	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	8.25e-62	5	379	10	380	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.53e-49	1	337	2	306	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO69124.1	5.07e-171	1	387	1	378
AII64873.1	7.45e-171	1	387	1	379
AND19645.1	7.45e-171	1	387	1	379
QJR71433.1	7.45e-171	1	387	1	379
QJR62835.1	7.45e-171	1	387	1	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	7.78e-31	5	357	11	354	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	2.04e-30	5	357	11	354	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	4.85e-67	2	388	6	381	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q2LVL8	4.55e-60	5	387	8	380	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q39T49	5.06e-59	2	378	8	373	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
B3E4H8	1.37e-58	2	387	8	382	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q02AZ6	1.00e-57	2	378	3	366	Lipid-A-disaccharide synthase OS=Solibacter usitatus (strain Ellin6076) OX=234267 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002575_00919.