CAZyme Information: MGYG000002575_01058

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae
• CAZyme ID: MGYG000002575_01058
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
288		31931.74	5.745

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002575	2444047	MAG	China	Asia

• Gene Location: Start: 128; End: 994 Strand: +

Full Sequence      

MVCSYGTLNPKSGQWEWSAPEEFTESIYEGLFGGRINGMFMGSGRICQSSRVKVGSAYRL
YAALCTHKGNYVIYSDDFGKNWKVLGDPVKSCAPKGDEPKCEELPDGSVLLSSRKAGGRY
FNIYKYTDVSTGSGAWGEAVDTRTVKNGISNQGSPTDGEILLVKAQRKSDNRIVDLALQS
IPIGPGRSHVGIYYKALDEPTDYDTPQHFAEHWEGVYEVTSRGSAYSTMTLQPDGRIGFY
FEEEPLWYQMIYLPLTIETITNGGYRLAANYRGEPFYSTTNTLSGPVK

Enzyme Prediction     

No EC number prediction in MGYG000002575_01058.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	12	244	4.7e-23	0.5847953216374269

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	1.00e-30	17	248	125	329	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFQ12979.1	6.75e-119	1	268	133	400
EFC70822.1	3.00e-89	14	265	146	402
ALO48969.1	4.37e-73	17	267	155	401
QYR10380.1	5.31e-73	17	266	152	396
QFQ13500.1	1.91e-63	13	284	743	1026

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5TSP_A	1.10e-06	72	267	256	454	Crystalstructure of the catalytic domain of Clostridium perfringens neuraminidase (NanI) in complex with a CHES [Clostridium perfringens ATCC 13124],5TSP_B Crystal structure of the catalytic domain of Clostridium perfringens neuraminidase (NanI) in complex with a CHES [Clostridium perfringens ATCC 13124]
2BF6_A	3.43e-06	72	263	255	449	AtomicResolution Structure of the bacterial sialidase NanI from Clostridium perfringens in complex with alpha-Sialic Acid (Neu5Ac). [Clostridium perfringens]
2VK5_A	3.45e-06	72	263	255	449	TheStructure Of Clostridium Perfringens Nani Sialidase And Its Catalytic Intermediates [Clostridium perfringens],2VK6_A The Structure Of Clostridium Perfringens Nani Sialidase And Its Catalytic Intermediates [Clostridium perfringens],2VK7_A The Structure Of Clostridium Perfringens Nani Sialidase And Its Catalytic Intermediates [Clostridium perfringens],2VK7_B The Structure Of Clostridium Perfringens Nani Sialidase And Its Catalytic Intermediates [Clostridium perfringens]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000025	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002575_01058.