CAZyme Information: MGYG000002575_01321

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae
• CAZyme ID: MGYG000002575_01321
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
188	MGYG000002575_110|CGC1	21960.46	5.2856

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002575	2444047	MAG	China	Asia

• Gene Location: Start: 7863; End: 8429 Strand: -

Full Sequence      

MDKNHLVSTGSEGLYGCESDEELCERIHRDDNIDYLTVHIWPYNWKWVDKTRLVDDLPHS
FMKTQWYIDLHTRMARGIGKPFVIEEFGYPRDRFSFSPGSSSTCRDSYFTYVMNAVLKSA
ERGGYLAGCNFWGWGGEAEPVHERWEKGDPYVCDPPHEPQGWYSVFQKDTSTREVIRSFV
HQIDSICN

Enzyme Prediction     

No EC number prediction in MGYG000002575_01321.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	1	134	8.8e-33	0.4290657439446367

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3934	COG3934	6.95e-16	5	176	282	458	Endo-1,4-beta-mannosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUB80388.1	3.37e-76	1	186	239	424
AUI54275.1	5.88e-76	1	186	234	419
ASE17030.1	1.18e-75	1	186	234	419
ADK96349.1	1.18e-75	1	186	234	419
QUB65854.1	1.35e-75	1	186	239	424

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1UUQ_A	1.35e-44	1	179	245	425	Exo-mannosidasefrom Cellvibrio mixtus [Cellvibrio mixtus],1UZ4_A Common inhibition of beta-glucosidase and beta-mannosidase by isofagomine lactam reflects different conformational intineraries for glucoside and mannoside hydrolysis [Cellvibrio mixtus],7ODJ_AAA Chain AAA, Man5A [Cellvibrio mixtus]
4LYP_A	2.89e-28	5	179	261	436	CrystalStructure of Glycoside Hydrolase Family 5 Mannosidase from Rhizomucor miehei [Rhizomucor miehei],4LYP_B Crystal Structure of Glycoside Hydrolase Family 5 Mannosidase from Rhizomucor miehei [Rhizomucor miehei]
4LYQ_A	2.89e-28	5	179	261	436	CrystalStructure of Glycoside Hydrolase Family 5 Mannosidase from Rhizomucor miehei, E202A mutant [Rhizomucor miehei],4NRR_A Crystal Structure of Glycoside Hydrolase Family 5 Mannosidase (E202A mutant) from Rhizomucor miehei in complex with mannosyl-fructose [Rhizomucor miehei],4NRR_B Crystal Structure of Glycoside Hydrolase Family 5 Mannosidase (E202A mutant) from Rhizomucor miehei in complex with mannosyl-fructose [Rhizomucor miehei],4NRS_A Crystal Structure of Glycoside Hydrolase Family 5 Mannosidase (E202A mutant) from Rhizomucor miehei in complex with mannobiose [Rhizomucor miehei],4NRS_B Crystal Structure of Glycoside Hydrolase Family 5 Mannosidase (E202A mutant) from Rhizomucor miehei in complex with mannobiose [Rhizomucor miehei]
4LYR_A	2.02e-27	5	179	261	436	GlycosideHydrolase Family 5 Mannosidase from Rhizomucor miehei, E301A mutant [Rhizomucor miehei]
3ZIZ_A	1.18e-06	1	135	205	321	ChainA, Gh5 Endo-beta-1,4-mannanase [Podospora anserina]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9SG94	1.42e-11	1	132	229	365	Mannan endo-1,4-beta-mannosidase 3 OS=Arabidopsis thaliana OX=3702 GN=MAN3 PE=2 SV=1
Q9FJZ3	4.17e-10	1	132	229	362	Mannan endo-1,4-beta-mannosidase 7 OS=Arabidopsis thaliana OX=3702 GN=MAN7 PE=2 SV=1
Q9SG95	6.31e-09	1	132	228	364	Putative mannan endo-1,4-beta-mannosidase 4 OS=Arabidopsis thaliana OX=3702 GN=MAN4 PE=3 SV=1
Q0JJD4	2.98e-08	1	132	253	391	Mannan endo-1,4-beta-mannosidase 2 OS=Oryza sativa subsp. japonica OX=39947 GN=MAN2 PE=2 SV=2
Q9LW44	7.16e-08	1	132	228	364	Putative mannan endo-1,4-beta-mannosidase P OS=Arabidopsis thaliana OX=3702 GN=MANP PE=5 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002575_01321.