CAZyme Information: MGYG000002575_01554

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae
• CAZyme ID: MGYG000002575_01554
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
336	MGYG000002575_148|CGC1	38444.97	9.8577

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002575	2444047	MAG	China	Asia

• Gene Location: Start: 34; End: 1044 Strand: +

Full Sequence      

MEVVKDTTALFQYLRSGEADLIAYELPTEIITKTGFTPCASDSVTSTYSTLQKQTTGWAI
RNQAIKLKSAIDAWYKPTRKKKLIENTVETQTRISIPAKRNVRAPYISLQQGIISPYDAE
FMRHGQRIGWDWKLLAAQCYQESAFDPKAVSWAGARGLMQIMPGTADLLHLPFDQIHHPG
KNIEAAANYLKQLEKKFSDIPNRIDRICFVLAAYNGGYHHIRDAMKLTSKYKKNAGSWKD
VSFYVKALSTPTYYNDPIVKYGYMIGTETYNYVFSIMERWDIYRKGSGKNGNVGNVFQPN
RATKRNRFNTKQEILKPDEIEKLIQAKENTKEPINE

Enzyme Prediction     

No EC number prediction in MGYG000002575_01554.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	121	282	6.8e-27	0.8740740740740741

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	1.28e-72	121	285	1	161	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG4623	MltF	2.07e-35	102	322	256	461	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
PRK10859	PRK10859	5.68e-33	131	282	302	449	membrane-bound lytic murein transglycosylase MltF.
cd13401	Slt70-like	3.75e-26	116	285	5	151	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	1.36e-23	133	217	2	81	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEH15587.1	7.54e-75	1	308	125	431
ALO48082.1	1.32e-74	1	308	94	389
QUB48180.1	1.69e-72	1	308	95	390
QNT65891.1	7.07e-72	1	288	111	387
QJR97872.1	1.21e-71	1	285	40	322

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OZ9_A	1.49e-21	117	282	259	420	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with isoleucine [Pseudomonas aeruginosa PAO1]
4OWD_A	1.56e-21	117	282	266	427	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with cysteine [Pseudomonas aeruginosa PAO1],4OXV_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with valine [Pseudomonas aeruginosa PADK2_CF510],4P0G_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with bulgecin and muropeptide [Pseudomonas aeruginosa PAO1],4P11_A Native crystal structure of MltF Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
4OYV_A	1.56e-21	117	282	266	427	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with leucine [Pseudomonas aeruginosa PAO1]
5AA4_B	7.97e-21	117	282	252	413	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA4_A	7.97e-21	117	282	252	413	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A9R413	7.70e-27	106	276	279	443	Membrane-bound lytic murein transglycosylase F OS=Yersinia pestis bv. Antiqua (strain Angola) OX=349746 GN=mltF PE=3 SV=1
A7FFU9	7.70e-27	106	276	279	443	Membrane-bound lytic murein transglycosylase F OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) OX=349747 GN=mltF PE=3 SV=1
Q1CKD3	7.70e-27	106	276	279	443	Membrane-bound lytic murein transglycosylase F OS=Yersinia pestis bv. Antiqua (strain Nepal516) OX=377628 GN=mltF PE=3 SV=2
Q74SQ6	7.70e-27	106	276	279	443	Membrane-bound lytic murein transglycosylase F OS=Yersinia pestis OX=632 GN=mltF PE=1 SV=1
B1JRW4	7.70e-27	106	276	279	443	Membrane-bound lytic murein transglycosylase F OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) OX=502800 GN=mltF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002575_01554.