CAZyme Information: MGYG000002575_01914

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae
• CAZyme ID: MGYG000002575_01914
• CAZy Family: GH89
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
727		84467.95	6.8116

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002575	2444047	MAG	China	Asia

• Gene Location: Start: 201; End: 2384 Strand: -

Full Sequence      

MKRKSVYTCLVMLLMSLVLQAKDKDVAVAEALLKRLLPSYIESFQFQKLKGEKDCFTIES
VKDKIVIGGNNANSMAMGLNHYLKYYCLTTVSWYADIAVEIPEELPMVGEKVVSEARVDT
RFFLNYCTYGYTMPWWQWKEWERFIDWMALNGINMPLAITGQEAVWHKVWSKMGMSDIEI
RSYFTGPPYLPWHRMANIDRWNGPLPMEWLEHQVSLQKKILARERELNMKPVLPAFAGHV
PADLKRIYPEADIQHLGKWAGFADAYRCNFLNPNDALFAKIQKLFLDEQKKLFGTDHIYG
LDPFNEVDPPSFEPEYLRKIASDMYATLTAADPKAQWMQMTWMFYFDKDKWTSERMKALL
TGVPQNKMILLDYHCENVELWKRTEHFHDQPYIWCYLGNFGGNTTLTGNVKESGARLENA
LMNGGGNLKGIGSTLEGLDVVQFPYEYILEKAWNLNVDDNKWIECLADRHVGCVSQPVRD
AWKLLFNDIYVQVPRTLGTLPGYRPELNKNSEKRTSNVYSNVELLEVWRKLNEAPSDRRD
AFRLDLITVGRQVLGNYFLDVKMEFDRMVEAKDYQALKACGEKMKEILNDLDKLNAFHPY
CSLDKWIDDARKMGDSPQLKDYYEKNARNLITTWGGSLNDYASRSWAGLISDYYSKRWEV
YINTFINAVGEGVTVDQKQLENKLKEIEESWVNATERKNTRKDVHLTTGGLLSFSAFLFS
KYQRLVK

Enzyme Prediction     

No EC number prediction in MGYG000002575_01914.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	62	702	3.3e-234	0.975867269984917

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05089	NAGLU	0.0	121	454	1	332	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
pfam12972	NAGLU_C	3.13e-80	462	701	1	248	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
pfam12971	NAGLU_N	1.58e-28	29	106	3	81	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT79512.1	0.0	1	727	1	727
QDM10125.1	0.0	1	727	1	727
QRQ58944.1	0.0	1	727	1	727
SCV06896.1	0.0	1	727	1	727
ALJ47486.1	0.0	1	727	1	727

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XWH_A	1.80e-127	64	697	51	691	Crystalstructure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]
2VC9_A	1.14e-83	44	663	192	822	Family89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	1.29e-83	44	663	200	830	ChainA, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	1.15e-82	44	663	215	845	CpGH89(E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54802	8.55e-128	64	697	74	714	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2
Q9FNA3	3.07e-123	29	722	49	804	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000228	0.999157	0.000181	0.000145	0.000137	0.000130

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002575_01914.