CAZyme Information: MGYG000002578_00202

Basic Information

• Species: CAG-977 sp900553035
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-977; CAG-977; CAG-977 sp900553035
• CAZyme ID: MGYG000002578_00202
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
344	MGYG000002578_1|CGC1	37367.75	5.4651

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002578	2398245	MAG	China	Asia

• Gene Location: Start: 216800; End: 217834 Strand: -

Full Sequence      

MSNNISSAVIFGCSGTVLSDAEREFFARVRPLGFILFARNIDTPEQVAALVRSLRECVEQ
PGAPVLIDQEGGRVQRLKPPHWESRPAGKVFGDMYETDPEKALDAAHVNARFIGRDLKDL
GIDVDCLPLLDVPIDGAHDVIGDRAFSKDPRAVADLGIAVCEGLLAEGVMPVVKHLPGHG
RAFADSHLSLPMVSTARVDLERRDFEPFRQLASAPWGMTAHLLYTAIDAEKPASLSKRVI
GDIIRGYIGFRGFLLCDDLSMKALKGSFEERTAQALEAGCDAVLHCNGDRAEMEAVAAGV
RPLSDTALERLARAENMRSKAVRNAPEMDYARARKDLDGLLAGV

Enzyme Prediction     

No EC number prediction in MGYG000002578_00202.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	65	284	3.9e-39	0.9351851851851852

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	1.78e-83	7	337	6	338	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PRK05337	PRK05337	3.78e-69	15	340	10	332	beta-hexosaminidase; Provisional
pfam00933	Glyco_hydro_3	7.72e-52	14	314	15	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDK98255.1	1.01e-144	3	322	5	324
AVM77618.1	8.22e-144	3	322	5	324
AVM73715.1	8.22e-144	3	322	5	324
ARJ65389.1	7.23e-135	7	312	5	310
CUW40352.1	2.24e-131	7	322	5	320

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4G6C_A	2.86e-46	9	342	14	348	Crystalstructure of beta-hexosaminidase 1 from Burkholderia cenocepacia J2315 [Burkholderia cenocepacia J2315],4G6C_B Crystal structure of beta-hexosaminidase 1 from Burkholderia cenocepacia J2315 [Burkholderia cenocepacia J2315]
4GNV_A	3.00e-46	9	342	16	350	Crystalstructure of beta-hexosaminidase 1 from Burkholderia cenocepacia J2315 with bound N-Acetyl-D-Glucosamine [Burkholderia cenocepacia J2315],4GNV_B Crystal structure of beta-hexosaminidase 1 from Burkholderia cenocepacia J2315 with bound N-Acetyl-D-Glucosamine [Burkholderia cenocepacia J2315],4MSS_A Crystal structure of Burkholderia cenocepacia family 3 glycoside hydrolase (NagZ) bound to (3S,4R,5R,6S)-3-acetamido-4,5,6-trihydroxyazepane [Burkholderia cenocepacia J2315],4MSS_B Crystal structure of Burkholderia cenocepacia family 3 glycoside hydrolase (NagZ) bound to (3S,4R,5R,6S)-3-acetamido-4,5,6-trihydroxyazepane [Burkholderia cenocepacia J2315],5UTP_A Crystal structure of Burkholderia cenocepacia family 3 glycoside hydrolase (NagZ) bound to N-ethylbutyryl-PUGNAc [Burkholderia cenocepacia],5UTP_B Crystal structure of Burkholderia cenocepacia family 3 glycoside hydrolase (NagZ) bound to N-ethylbutyryl-PUGNAc [Burkholderia cenocepacia],5UTQ_A Crystal structure of Burkholderia cenocepacia family 3 glycoside hydrolase (NagZ) bound to PUGNAc [Burkholderia cenocepacia],5UTQ_B Crystal structure of Burkholderia cenocepacia family 3 glycoside hydrolase (NagZ) bound to PUGNAc [Burkholderia cenocepacia],5UTR_A Crystal structure of Burkholderia cenocepacia family 3 glycoside hydrolase (NagZ) bound to (3S,4R,5R,6S)-3-butyryl-4,5,6-trihydroxyazepane [Burkholderia cenocepacia],5UTR_B Crystal structure of Burkholderia cenocepacia family 3 glycoside hydrolase (NagZ) bound to (3S,4R,5R,6S)-3-butyryl-4,5,6-trihydroxyazepane [Burkholderia cenocepacia],6DTE_A GlcNAc-inspired cyclophellitol bound to NagZ [Burkholderia cenocepacia],6DTE_B GlcNAc-inspired cyclophellitol bound to NagZ [Burkholderia cenocepacia]
5G1M_A	1.29e-44	3	342	19	344	Crystalstructure of NagZ from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5G1M_B Crystal structure of NagZ from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5G2M_A Crystal structure of NagZ from Pseudomonas aeruginosa in complex with N-acetylglucosamine [Pseudomonas aeruginosa PAO1],5G2M_B Crystal structure of NagZ from Pseudomonas aeruginosa in complex with N-acetylglucosamine [Pseudomonas aeruginosa PAO1],5G3R_A Crystal Structure Of Nagz From Pseudomonas Aeruginosa In Complex With N-acetylglucosamine And L-ala-1,6-anhydromurnac [Pseudomonas aeruginosa PAO1],5G3R_B Crystal Structure Of Nagz From Pseudomonas Aeruginosa In Complex With N-acetylglucosamine And L-ala-1,6-anhydromurnac [Pseudomonas aeruginosa PAO1],5G5K_A Crystal structure of NagZ from Pseudomonas aeruginosa in complex with the inhibitor 2-acetamido-1,2-dideoxynojirimycin [Pseudomonas aeruginosa PAO1],5G5K_B Crystal structure of NagZ from Pseudomonas aeruginosa in complex with the inhibitor 2-acetamido-1,2-dideoxynojirimycin [Pseudomonas aeruginosa PAO1]
3TEV_A	6.79e-44	20	283	32	290	Thecrystal structure of glycosyl hydrolase from Deinococcus radiodurans R1 [Deinococcus radiodurans R1],3TEV_B The crystal structure of glycosyl hydrolase from Deinococcus radiodurans R1 [Deinococcus radiodurans R1]
5G5U_A	3.74e-43	3	342	19	344	Crystalstructure of NagZ H174A mutant from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5G5U_B Crystal structure of NagZ H174A mutant from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5G6T_A Crystal structure of Zn-containing NagZ H174A mutant from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5G6T_B Crystal structure of Zn-containing NagZ H174A mutant from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5LY7_A Crystal structure of NagZ H174A mutant from Pseudomonas aeruginosa in complex with the inhibitor 2-acetamido-1,2-dideoxynojirimycin [Pseudomonas aeruginosa PAO1],5LY7_B Crystal structure of NagZ H174A mutant from Pseudomonas aeruginosa in complex with the inhibitor 2-acetamido-1,2-dideoxynojirimycin [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0A911	3.98e-55	9	311	6	310	Beta-hexosaminidase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) OX=187272 GN=nagZ PE=3 SV=1
Q0AF74	4.34e-54	14	287	11	284	Beta-hexosaminidase OS=Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57) OX=335283 GN=nagZ PE=3 SV=1
Q82SJ8	1.85e-52	14	287	11	284	Beta-hexosaminidase OS=Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298) OX=228410 GN=nagZ PE=3 SV=1
Q2KXM7	2.45e-49	9	311	15	306	Beta-hexosaminidase OS=Bordetella avium (strain 197N) OX=360910 GN=nagZ PE=3 SV=1
Q7NWB7	8.06e-49	9	302	8	300	Beta-hexosaminidase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) OX=243365 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002578_00202.