CAZyme Information: MGYG000002579_00333

Basic Information

• Species: Ligilactobacillus sp900765635
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Ligilactobacillus; Ligilactobacillus sp900765635
• CAZyme ID: MGYG000002579_00333
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
336	MGYG000002579_3|CGC3	38256.89	4.4786

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002579	1757018	MAG	China	Asia

• Gene Location: Start: 68050; End: 69060 Strand: +

Full Sequence      

MEQWFKEAQYGMMIHWGLYSLLAGEYRGQSSSSYAEWVQSKLQIPNAEYEKLATIFKPIY
FDADEIVALAKEAGMKYLVITTKHHDGFAMYHSKVDTYNIYDATPFKRDIIGELAQACRK
AGLKFGIYYSQDLDWHDPNGGGYLSNDIETAGTTWDNSWDFTGDKNFDICFENKIMPQIE
EIMTNYGEIATAWFDVPMTLSDEQSQRIYDTVKKLQPNCLINSRLGNGKYDYVSLGDNEI
PQDLTQTEGEVDYNAVDGLKPSPTGLYETAATMNDSWGFSYHDQNWKSPQTICDYRKHLA
DLGINYLLNVGLDGLGRVPLIARDNLLAAKKLMDEK

Enzyme Prediction     

No EC number prediction in MGYG000002579_00333.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	3	334	5.5e-84	0.8526011560693642

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01120	Alpha_L_fucos	2.24e-78	1	328	18	323	Alpha-L-fucosidase.
smart00812	Alpha_L_fucos	4.79e-73	1	334	19	331	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
COG3669	AfuC	6.61e-35	15	335	1	314	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam14871	GHL6	1.54e-09	62	140	1	89	Hypothetical glycosyl hydrolase 6. GHL6 is a family of hypothetical glycoside hydrolases.
cd07431	PHP_PolIIIA	0.002	64	127	19	62	Polymerase and Histidinol Phosphatase domain of alpha-subunit of bacterial polymerase III. PolIIIAs that contain an N-terminal PHP domain have been classified into four basic groups based on genome composition, phylogenetic, and domain structural analysis: polC, dnaE1, dnaE2, and dnaE3. The PHP (also called histidinol phosphatase-2/HIS2) domain is associated with several types of DNA polymerases, such as PolIIIA and family X DNA polymerases, stand alone histidinol phosphate phosphatases (HisPPases), and a number of uncharacterized protein families. DNA polymerase III holoenzyme is one of the five eubacterial DNA polymerases that is responsible for the replication of the DNA duplex. The alpha subunit of DNA polymerase III core enzyme catalyzes the reaction for polymerizing both DNA strands. The PolIIIA PHP domain has four conserved sequence motifs and contains an invariant histidine that is involved in metal ion coordination, and like other PHP structures, exhibits a distorted (beta/alpha) 7 barrel and coordinates up to 3 metals. Initially, it was proposed that PHP region might be involved in pyrophosphate hydrolysis, but such activity has not been found. It has been shown that the PHP domain of PolIIIA has a trinuclear metal complex and is capable of proofreading activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALB28421.1	3.43e-206	3	332	6	337
AYE37750.1	3.02e-205	3	332	6	337
AKU60913.1	3.38e-205	4	335	7	341
ARE44411.1	3.38e-205	4	335	7	341
QDR74560.1	3.38e-205	4	335	7	341

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6O18_A	1.05e-205	4	335	7	341	ChainA, AlfC [Lacticaseibacillus casei],6O18_B Chain B, AlfC [Lacticaseibacillus casei],6O18_C Chain C, AlfC [Lacticaseibacillus casei],6O18_D Chain D, AlfC [Lacticaseibacillus casei],6O1A_A Chain A, AlfC [Lacticaseibacillus casei],6O1A_B Chain B, AlfC [Lacticaseibacillus casei],6O1A_C Chain C, AlfC [Lacticaseibacillus casei],6O1A_D Chain D, AlfC [Lacticaseibacillus casei]
6O1I_A	8.61e-205	4	335	7	341	ChainA, AlfC [Lacticaseibacillus casei],6O1I_B Chain B, AlfC [Lacticaseibacillus casei],6O1I_C Chain C, AlfC [Lacticaseibacillus casei],6O1I_D Chain D, AlfC [Lacticaseibacillus casei]
6O1J_A	1.74e-204	4	335	7	341	ChainA, AlfC [Lacticaseibacillus casei],6O1J_B Chain B, AlfC [Lacticaseibacillus casei],6O1J_C Chain C, AlfC [Lacticaseibacillus casei],6O1J_D Chain D, AlfC [Lacticaseibacillus casei],6O1J_E Chain E, AlfC [Lacticaseibacillus casei],6O1J_F Chain F, AlfC [Lacticaseibacillus casei],6O1J_G Chain G, AlfC [Lacticaseibacillus casei],6O1J_H Chain H, AlfC [Lacticaseibacillus casei]
6O1C_A	1.74e-204	4	335	7	341	ChainA, AlfC [Lacticaseibacillus casei],6O1C_B Chain B, AlfC [Lacticaseibacillus casei],6O1C_C Chain C, AlfC [Lacticaseibacillus casei],6O1C_D Chain D, AlfC [Lacticaseibacillus casei],6O1C_E Chain E, AlfC [Lacticaseibacillus casei],6O1C_F Chain F, AlfC [Lacticaseibacillus casei],6O1C_G Chain G, AlfC [Lacticaseibacillus casei],6O1C_H Chain H, AlfC [Lacticaseibacillus casei],6OHE_A Chain A, AlfC [Lacticaseibacillus casei],6OHE_B Chain B, AlfC [Lacticaseibacillus casei],6OHE_C Chain C, AlfC [Lacticaseibacillus casei],6OHE_D Chain D, AlfC [Lacticaseibacillus casei]
7DB5_A	1.37e-65	1	319	34	338	ChainA, Alpha-L-fucosidase [Vibrio sp. EJY3]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P17164	3.97e-23	1	331	45	356	Tissue alpha-L-fucosidase OS=Rattus norvegicus OX=10116 GN=Fuca1 PE=1 SV=1
P49713	1.54e-22	1	326	30	335	Putative alpha-L-fucosidase OS=Caenorhabditis elegans OX=6239 GN=W03G11.3 PE=3 SV=2
Q2KIM0	8.99e-22	1	331	52	363	Tissue alpha-L-fucosidase OS=Bos taurus OX=9913 GN=FUCA1 PE=2 SV=1
Q60HF8	1.66e-21	1	331	51	362	Tissue alpha-L-fucosidase OS=Macaca fascicularis OX=9541 GN=FUCA1 PE=2 SV=1
Q99LJ1	2.05e-21	1	331	35	346	Tissue alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002579_00333.