CAZyme Information: MGYG000002579_00586

Basic Information

• Species: Ligilactobacillus sp900765635
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Ligilactobacillus; Ligilactobacillus sp900765635
• CAZyme ID: MGYG000002579_00586
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
477	MGYG000002579_7|CGC2	55181.2	5.2204

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002579	1757018	MAG	China	Asia

• Gene Location: Start: 40635; End: 42068 Strand: -

Full Sequence      

MTQDTRKFPENFLWGGAVAAHQLEGGYREGGKGLSTADLSTLGSKDHPRENTATIEEGKY
YPNHQGIDFYHRYPEDIKLFAEMGFKCFRTSIAWTRIFPNGDEKTPNEEGLKFYDDMFDE
CLKYGIQPVITLSHFEMPYHLVTEYGGWRDRRLIDFFLNFAEVCFKRYHKKVKYWMTFNE
INNQTNFESAGAVYSDSGLVFGPDDNKEQLMYQAAHYELVASAKAVALGHQIDPSLQIGS
MIAMCPIYPISSKPEDILFAQRAMQTRYWFSDVHCNGFYPKWLLNHFETQGFEMDITPAD
LAALKEGTVDYIGFSYYMSFAVKYKGNLLYNENHDLVANPYVKASEWGWQVDPVGLRYAL
NWFTDRYHLPLFIVENGLGAIDKLEENNEIHDDYRIKYLREHLEQVKKAILDDGVDLLGY
TPWGCIDLIAASTGQMCKRYGFIYVDQDDYGQGSLKRYKKDSFYWYQNVIATNGAQL

Enzyme Prediction     

EC	3.2.1.86	3.2.1.23	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	6	474	2.2e-151	0.9906759906759907

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	7	477	3	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	8	477	4	473	cryptic 6-phospho-beta-glucosidase; Provisional
PRK15014	PRK15014	0.0	7	477	5	477	6-phospho-beta-glucosidase BglA; Provisional
COG2723	BglB	0.0	5	474	1	454	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	8	477	6	477	6-phospho-beta-glucosidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SFV41399.1	1.15e-302	1	477	1	477
QJU50436.1	2.59e-290	1	477	1	477
AVW09384.1	2.59e-290	1	477	1	477
AYJ37651.1	2.59e-290	1	477	1	477
QHM45683.1	2.13e-289	1	477	1	477

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QOM_A	4.83e-281	6	477	9	480	Crystalstructure of 6-phospho-beta-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],4GZE_A Chain A, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_B Chain B, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_C Chain C, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_D Chain D, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_E Chain E, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_F Chain F, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1]
4F66_A	9.91e-248	7	477	6	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	2.83e-247	7	477	6	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3PN8_A	1.14e-239	7	477	6	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]
2XHY_A	3.46e-217	9	477	9	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42973	2.00e-218	9	477	5	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
Q46829	1.89e-216	9	477	9	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P40740	7.50e-192	1	477	1	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P26206	2.22e-175	8	477	5	463	6-phospho-beta-glucosidase OS=Dickeya chrysanthemi OX=556 GN=arbB PE=3 SV=1
P24240	4.95e-174	8	477	4	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000008	0.000026	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002579_00586.