CAZyme Information: MGYG000002580_00675

Basic Information

• Species: Lachnospira sp000436475
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnospira; Lachnospira sp000436475
• CAZyme ID: MGYG000002580_00675
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
313	MGYG000002580_3|CGC1	35255.46	5.2106

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002580	3016685	MAG	China	Asia

• Gene Location: Start: 18605; End: 19546 Strand: +

Full Sequence      

MITVSKDNTGDFSSVQAAVDSINSACGGETIFIKNGIYKERVEIKKDNITLIGESSEHTI
ITEGYYALMTMEDGSKRGTFRSYTFFVNANNFSAFNLTFENSAGFGKKVGQAIAVYAEGD
NLTFKNCRMLGHQDTLFTGPLPFKEKEPGGFIGPTEFAPRIPTKQLYEDCYICGEIDFIF
GSATAYFKNCTLYALNRNETINSYYTAPSTYENQQYGYVFDSCTFTGNCPPQTCYLSRPW
RIHAKVVLLNCEYSDQVVKDGFHDWNKPEAHDTVYYAEYNGHGPGYCPDKRASFAHILTD
EEAAIYKKEYILK

Enzyme Prediction     

No EC number prediction in MGYG000002580_00675.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	2	311	3.8e-91	0.9826388888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	6.49e-72	1	313	83	403	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	1.46e-61	2	303	2	286	Pectinesterase.
PLN02773	PLN02773	2.65e-57	1	304	6	288	pectinesterase
PLN02432	PLN02432	3.84e-52	1	311	12	286	putative pectinesterase
PLN02682	PLN02682	7.44e-50	2	303	71	352	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR72174.1	5.41e-170	1	312	1	311
ADZ82949.1	1.11e-114	4	312	3	312
SET76962.1	2.16e-114	1	312	1	313
QEH68466.1	4.50e-114	4	312	3	312
BCJ93650.1	1.24e-111	1	312	7	318

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2NSP_A	1.51e-31	4	312	8	334	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
3UW0_A	1.59e-30	4	285	35	334	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
1XG2_A	2.60e-29	4	305	7	290	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	2.70e-29	2	303	9	293	Pectinmethylesterase from Carrot [Daucus carota]
1QJV_A	2.06e-27	4	312	8	334	ChainA, PECTIN METHYLESTERASE [Dickeya chrysanthemi],1QJV_B Chain B, PECTIN METHYLESTERASE [Dickeya chrysanthemi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	3.93e-43	1	303	6	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q9ZQA4	1.52e-37	1	304	41	319	Putative pectinesterase 14 OS=Arabidopsis thaliana OX=3702 GN=PME14 PE=2 SV=1
Q9SRX4	2.27e-36	1	304	264	552	Probable pectinesterase/pectinesterase inhibitor 7 OS=Arabidopsis thaliana OX=3702 GN=PME7 PE=2 SV=1
Q9SMY6	5.45e-36	3	303	298	581	Putative pectinesterase/pectinesterase inhibitor 45 OS=Arabidopsis thaliana OX=3702 GN=PME45 PE=2 SV=1
Q43062	6.44e-36	4	285	211	473	Pectinesterase/pectinesterase inhibitor PPE8B OS=Prunus persica OX=3760 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000011	0.000021	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002580_00675.