CAZyme Information: MGYG000002581_00109

Basic Information

• Species: CAG-269 sp001916065
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; CAG-269; CAG-269 sp001916065
• CAZyme ID: MGYG000002581_00109
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
230	MGYG000002581_1|CGC2	26487.79	8.5516

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002581	1543318	MAG	China	Asia

• Gene Location: Start: 81191; End: 81883 Strand: +

Full Sequence      

MKVIKNIIFVAIVFLISIGLLVVGNGYDMYKDAISKIPLTEKVETIKEKENYTKIEEVPE
IYIKAVISVEDHRFYKHNGIDIIAIGRATINDIKAMSFVEGGSTITQQLSKNIYFTQEKK
ITRKIAEVFMSFEIEKNYNKDEILELYLNTSYFGEGCYTVKEASRKYFGKEPKKMTDYEA
IMLAGIPNAPSVYSLTKNPELAKQRQKQVINKMIEYKYLTQSEADKILEQ

Enzyme Prediction     

No EC number prediction in MGYG000002581_00109.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	45	213	8.6e-63	0.9548022598870056

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	4.20e-80	48	213	11	176	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	3.17e-78	52	226	4	178	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	2.81e-73	1	230	9	257	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	3.76e-67	1	226	2	243	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK11636	mrcA	1.17e-45	1	226	1	242	penicillin-binding protein 1a; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SET89048.1	8.98e-85	4	230	7	233
QRP41835.1	1.23e-84	25	224	28	227
ASN93505.1	1.23e-84	25	224	28	227
QJU22158.1	3.52e-84	25	224	28	227
QIX92252.1	1.00e-83	25	224	28	227

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	3.17e-44	48	230	18	200	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	1.26e-43	48	230	18	200	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
5ZZK_A	1.68e-36	41	230	48	243	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]
3HZS_A	1.79e-36	41	230	12	207	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus MW2]
6FTB_A	1.84e-36	41	230	13	208	Staphylococcusaureus monofunctional glycosyltransferase in complex with moenomycin [Staphylococcus aureus MW2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5FAC7	1.83e-44	47	230	65	248	Penicillin-binding protein 1A OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) OX=242231 GN=mrcA PE=3 SV=3
O05131	1.83e-44	47	230	65	248	Penicillin-binding protein 1A OS=Neisseria gonorrhoeae OX=485 GN=mrcA PE=1 SV=3
P0A0Z5	1.83e-44	47	230	65	248	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) OX=122587 GN=mrcA PE=3 SV=1
P0A0Z6	1.83e-44	47	230	65	248	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=mrcA PE=3 SV=1
O87579	2.50e-44	47	230	65	248	Penicillin-binding protein 1A OS=Neisseria lactamica OX=486 GN=mrcA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.731865	0.258321	0.007140	0.000652	0.000383	0.001632

TMHMM  Annotations     

start	end
7	29