CAZyme Information: MGYG000002584_00014

Basic Information

• Species: Akkermansia sp900545155
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia; Akkermansia sp900545155
• CAZyme ID: MGYG000002584_00014
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
404	MGYG000002584_1|CGC1	46001.64	6.9386

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002584	3044716	MAG	China	Asia

• Gene Location: Start: 14234; End: 15448 Strand: -

Full Sequence      

MGSLCFFSILNQTNMTHTLRISVLSLASIGCLVLAGVSSMAEEENVVLSEESSQTFSSAF
NKADVLKVGNSVAEWQMENFSKMKSSSFPESWLNGALYLGMMDWADLTGDKKIDDWLMKK
FNSFKWRPAPRMYHADDVAVCQTYLDMYRKHKKETMLWPTQARTEWVVNHPSQGSMDLNY
GKPSSLERWSWCDALFMAPPVYARMYALTGDRKFMDFADKEYKATYDKLFDKEENLFFRD
STYFGKKEANGKKIFWGRGNGWVVGGLAEMLKELPQDDKTYRPFYEKLFVTLCSRLLKLQ
CKDGFWRASLLDPESYPSPETSATGFITYGMAYGVEQGILPRDQFLPAVEKGWKALVNSV
GPDGKLYWVQPVGADPKHVDKQNTEVYGVGAFLLTAAEVYKLSK

Enzyme Prediction     

No EC number prediction in MGYG000002584_00014.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	86	401	1.4e-88	0.9728915662650602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	6.41e-104	72	402	5	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	1.57e-56	92	403	36	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT48952.1	8.89e-164	11	403	48	439
QUT74307.1	3.22e-158	60	402	23	366
ASM65072.1	8.54e-150	46	404	12	372
QUU06865.1	8.54e-150	46	404	12	372
QRP56352.1	8.54e-150	46	404	12	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CE7_A	3.74e-80	38	402	8	369	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
5NOA_A	1.01e-52	92	398	56	370	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	1.04e-48	92	398	39	353	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
1NC5_A	2.67e-07	95	402	44	367	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.08e-06	95	402	34	357	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WF04	1.46e-81	15	399	1	408	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
L7P9J4	5.02e-79	89	402	57	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	5.59e-78	89	404	55	377	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
O34559	1.46e-06	95	402	44	367	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.010996	0.786950	0.200683	0.000628	0.000397	0.000321

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002584_00014.