CAZyme Information: MGYG000002584_00169

Basic Information

• Species: Akkermansia sp900545155
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia; Akkermansia sp900545155
• CAZyme ID: MGYG000002584_00169
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
486	MGYG000002584_1|CGC4	53833.56	7.1534

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002584	3044716	MAG	China	Asia

• Gene Location: Start: 240298; End: 241758 Strand: +

Full Sequence      

MDTSSSRRRFLQTLGLASGAIAAGGLITPARAQESAAGQIVVPNPDMIGPSTDWTPRPAG
SKYMGGFRAPKLDVVKVAFVGVGERGSMHVSQMCSIEGAEVVGICDLYEARCEHNAATVE
KKTGKRPPIFCKGDQDYLRMFKEVKPDAVIICPSWEWHARITCDAMKNHIHAFTEVPIAI
KMDELWDIVNTCEACQVHCMQMENVNYGREELMFLNMVRQGVIGDLLHGEAAYIHELRGQ
MYQDTPGKGNAGTGSWRTYHYAEHNGNLYPTHGLGPVAQYMNLARTDDNFGRLVSFSSPS
IGRALFAKKNFPADHKWNKLDFKGGDMNTSIIKTTMGRTILVEWDETSPRPYSRMNLIQG
VLGTLAGFPTRVAGEKLGNGNYHAWIEGNEALAPIYEKYDHPLWKRLGDLAKKMGGHGGM
DFIMLYRMIECLRKGEPMDQNVYEGAFWSAVTPLSETSVAQGGMPQVFPDFTRGDWKTTA
PLGIVQ

Enzyme Prediction     

EC	3.2.1.49

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	71	478	7.2e-156	0.9924812030075187

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01408	GFO_IDH_MocA	5.64e-12	75	207	1	120	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
COG0673	MviM	6.52e-11	75	235	4	157	Predicted dehydrogenase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHV74239.1	1.24e-291	1	486	1	481
QWP73299.1	1.24e-291	1	486	1	481
QUY58196.1	1.24e-291	1	486	1	481
QWP60889.1	1.24e-291	1	486	1	481
QHV61872.1	1.24e-291	1	486	1	481

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	2.85e-215	56	485	24	447	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	7.51e-77	75	477	21	432	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B2UL75	4.56e-288	1	486	1	481	Glycosyl hydrolase family 109 protein 1 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_0017 PE=3 SV=1
B2UQL7	1.79e-222	1	485	1	472	Glycosyl hydrolase family 109 protein 2 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_0920 PE=1 SV=1
A3D6B7	2.04e-164	7	485	6	457	Glycosyl hydrolase family 109 protein OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) OX=325240 GN=Sbal_2793 PE=3 SV=1
A6WQ58	2.89e-164	7	485	6	457	Glycosyl hydrolase family 109 protein OS=Shewanella baltica (strain OS185) OX=402882 GN=Shew185_2813 PE=3 SV=1
Q8ECL7	8.21e-164	7	485	6	457	Alpha-N-acetylgalactosaminidase OS=Shewanella oneidensis (strain MR-1) OX=211586 GN=nagA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as TAT

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	0.000000	0.999974	0.000005	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002584_00169.