CAZyme Information: MGYG000002584_00329

Basic Information

• Species: Akkermansia sp900545155
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia; Akkermansia sp900545155
• CAZyme ID: MGYG000002584_00329
• CAZy Family: GH37
• CAZyme Description: Periplasmic trehalase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
473		53320.95	7.1251

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002584	3044716	MAG	China	Asia

• Gene Location: Start: 126431; End: 127852 Strand: +

Full Sequence      

MNPTDFKILALCSGLTLASLPLLPAHAEGAGGRPETPPASSQPGAINDDNFTPEFMKAFY
EGALKIADRKIAQVEKADKQSPPKVPLKPRLATGGGFSGLFLWDTVFCTLWAKHAPDHFP
ITTSLDNFYMLQEPDGFICREFQRDGKPYWSREHPISFNPPILCWAEWELFESGVTDKAR
LHTVYPHLKKHHDFCWKAYRRDDGLFYGDALGGGMDDLPRLPKKPGFSMAGGINIEEKHI
TADSKGMWNVVKNNPLYCWNKQMGWIDISSQMAFNALNLSRIAEILGNKDDAARYRAQHA
EMAKLINEKCWDEKLGFYCDYYQGETIPRLHAGAFWALIAEIVPKERVPKIVATLKDPAT
FNRPVPLPTLAANEPEYNPEHGYWHGSVWPPTTYVAIRGLMKLGERDLALDIARRYYNAN
AQLWRKTGTVFENISPEQCDHPKDRAGNDFCGWGGLAPIALYKELLLPEANKK

Enzyme Prediction     

No EC number prediction in MGYG000002584_00329.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	266	447	2e-22	0.3564154786150713

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	5.98e-24	160	437	419	759	alpha-glucosidase; Provisional
pfam03200	Glyco_hydro_63	1.31e-16	85	456	83	487	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
pfam01204	Trehalase	4.45e-15	266	432	305	471	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
COG1626	TreA	1.63e-11	266	416	354	499	Neutral trehalase [Carbohydrate transport and metabolism].
COG3408	GDB1	8.20e-11	127	410	310	558	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44932.1	6.09e-129	59	466	7	408
AVI50514.1	8.43e-106	49	467	42	460
AXT61762.1	3.95e-94	46	466	57	483
QHT63246.1	4.44e-69	100	464	109	447
QIN83484.1	2.99e-68	100	460	90	429

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	3.25e-11	266	436	551	731	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	3.25e-11	266	436	551	731	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
6XUX_A	3.50e-11	266	436	100	280	ChainA, Nanobody,Glucosidase YgjK,Glucosidase YgjK,Nanobody [Escherichia coli K-12]
7PQQ_B	3.50e-11	266	436	100	280	ChainB, Anti-RON nanobody,Megabody 91,Glucosidase YgjK [Lama glama]
7Q6Z_B	3.52e-11	266	436	122	302	ChainB, Megabody 177 [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94250	1.97e-22	122	416	76	331	Uncharacterized protein BB_0381 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0381 PE=4 SV=2
P42592	1.80e-10	266	436	574	754	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000643	0.998449	0.000288	0.000238	0.000183	0.000162

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002584_00329.