CAZyme Information: MGYG000002584_02259

Basic Information

• Species: Akkermansia sp900545155
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia; Akkermansia sp900545155
• CAZyme ID: MGYG000002584_02259
• CAZy Family: GH0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
719	MGYG000002584_27|CGC1	79933.64	4.9392

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002584	3044716	MAG	China	Asia

• Gene Location: Start: 5821; End: 7980 Strand: -

Full Sequence      

MSSCETPIFRSEEFLVFPNRVVQRNGREAVVADDGTVWSYGNRERPSWKMSGGVKELASY
EGPIPVLNAAYDLAVREFLESRGDEGVLLTGASWGKSVWTRDVSFATTLGLGMVDPDICM
ASLKVRVSHGEVMQDTGTGGSWPISTDRVAWGIAAWDLYLITGDREWLEWSAKVLDRTCL
HDILVVDELSGLVRGESSFLDWRSQSYPDWMTPADIGESCSLSTMALHARCRAILGEMYA
ELGDQSKAGYWKKAAERVRKAIETMFRIPHRPAYGQFLYGRGYPVLSERIDTLGSLLCLL
FGIVDGEEAASFLYELPHCLMGVPCFHPQKTMTAMDYHNGTMWPFLEGFYAQTAASLGNE
DAMSASLACLVRSSLINGTNKENISLIHGTDEGLVQSSDRQLWSIAGTLGVFLKGLFGIW
CENDSLMLSPCVPKEWAGRHVLMGVKYRKATIDVILLGHGSQVGKCMVNGKTGVPVIEKS
AEGHFIVEIELLPGDPSVNGINWSPVSYDLPSPQWIHEGNELRWEPVPDAWYYRVYRNGI
PIAQTEQTVFVPHPMAAVNQYQVMAVSKDDRESFLNEPREYIPGNARVETRPCGLSGDDV
WVSRMDGSRHAYFYDVILGQSGVYRVDAFFSNGSGDYKDGNTCALRSLVLNGKRVGSLVF
PHMNTQGDWGNFFYTPGLDVPLAAGIYTVELTYGEEDENINHDVNDCLIKHMRFTRISP

Enzyme Prediction     

No EC number prediction in MGYG000002584_02259.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3408	GDB1	6.57e-10	54	455	234	641	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
cd04083	CBM35_Lmo2446-like	8.37e-05	621	703	48	121	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.
pfam17389	Bac_rhamnosid6H	9.19e-05	136	266	88	213	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMU30083.1	5.53e-135	47	718	210	890
QEC42842.1	1.27e-134	42	718	211	896
QHL86661.1	2.90e-134	48	715	223	897
BAX82107.1	7.48e-133	8	717	32	740
AKQ46615.1	1.00e-131	41	717	221	905

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002584_02259.