CAZyme Information: MGYG000002585_01799

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000002585_01799
• CAZy Family: GH53
• CAZyme Description: Arabinogalactan endo-beta-1,4-galactanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
366	MGYG000002585_50|CGC1	41290.77	4.8854

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002585	2701793	MAG	China	Asia

• Gene Location: Start: 14034; End: 15134 Strand: +

Full Sequence      

MKHMSFFTFSFCIAFAILACSSHNGTEPDAGKLPEDENPVTTDFAKGADISWVTEMEHNG
LKFYNAGGQETECFRLMKDLGLDAVRLRVWVNPEEHGGWCDKEDLLVKARRAKNLGMNVM
VDFHYSDWWADPAKQNIPAAWKSHSYEQMKTDVAEHTIEVLQLLKDNQITPKWVQVGNET
SNGFLWEMGQADRNPKQYAGLFAAGYEAVKKVFPQSIVIVHLDNGFDNDLYNWNLDILKN
NGAKWDMIGMSLYPYWAMDSGKETSAGKTITDCIANIKKVSEKYDCDVMIVETGMECADD
NGKLASAAVLAEGKAQLSRILKECRDNTNGRCKGVFYWEPECKPSQYRLGAFTEDGYPTI
IMDAFK

Enzyme Prediction     

No EC number prediction in MGYG000002585_01799.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH53	46	346	5.2e-106	0.9005847953216374

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07745	Glyco_hydro_53	6.97e-104	45	358	1	313	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.
COG3867	GanB	1.12e-98	13	359	5	355	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SCM59778.1	7.85e-190	16	366	16	359
QQA29074.1	4.11e-188	1	366	1	391
QUT60591.1	4.11e-188	1	366	1	391
QUT98175.1	1.67e-187	1	366	1	391
ADD61507.1	1.67e-187	1	366	1	391

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GPA_A	9.78e-96	44	366	7	314	Beta-1,4-galactanasefrom Bacteroides thetaiotaomicron with galactose [Bacteroides thetaiotaomicron VPI-5482],6GPA_B Beta-1,4-galactanase from Bacteroides thetaiotaomicron with galactose [Bacteroides thetaiotaomicron VPI-5482]
6GP5_A	1.17e-95	25	366	20	350	Beta-1,4-galactanasefrom Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],6GP5_B Beta-1,4-galactanase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OSK_A	1.07e-50	38	338	41	352	ChainA, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230],7OSK_B Chain B, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230]
1R8L_A	2.59e-49	30	344	10	326	Thestructure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1R8L_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1UR0_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR0_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],2CCR_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2CCR_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis]
2GFT_A	1.95e-48	30	344	10	326	ChainA, Glycosyl Hydrolase Family 53 [Bacillus licheniformis],2GFT_B Chain B, Glycosyl Hydrolase Family 53 [Bacillus licheniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48843	1.38e-52	44	366	6	336	Uncharacterized protein in bgaB 5'region (Fragment) OS=Niallia circulans OX=1397 PE=3 SV=1
O07013	1.95e-48	40	344	49	355	Endo-beta-1,4-galactanase OS=Bacillus subtilis (strain 168) OX=224308 GN=ganB PE=1 SV=1
Q65CX5	2.45e-48	30	344	35	351	Endo-beta-1,4-galactanase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=ganB PE=1 SV=1
Q0CTQ7	6.22e-43	46	340	19	314	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=galA PE=3 SV=1
A1D3T4	2.24e-39	46	340	26	321	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=galA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	1.000068	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002585_01799.