CAZyme Information: MGYG000002586_01424

Basic Information

• Species: CAG-145 sp002320005
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Anaerovoracaceae; CAG-145; CAG-145 sp002320005
• CAZyme ID: MGYG000002586_01424
• CAZy Family: GH18
• CAZyme Description: Spore germination protein YaaH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
309		34825.07	3.9816

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002586	1661999	MAG	China	Asia

• Gene Location: Start: 103; End: 1032 Strand: -

Full Sequence      

MIVNGYAYPSIMPEVLQWWLPRLSWLSCFSYGFTAEGELINLEDENLIQAAGDYGVRPMM
VLTPMDENGAFNDEVASAVFEDPEAEANLIDNIEENIISKGMGGVDFDFEYIRGRYADNY
VELVARTRDRLSPQGYLTTVALAPKTSADQPGLLYQGHDYGGMGEAADYCLLMTYEWGYT
YGEPMAVSPINNVRRVVEYGITEIPAEKILLGMSNYGYDWTLPFVRGESRAEKLSNYQAE
ARAAYYGVPPEFDQEAASPFFRYTDEAGRQHIVWFENLASWQARLSLVEEYGLAGISIWN
IMSIFYGGI

Enzyme Prediction     

No EC number prediction in MGYG000002586_01424.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	73	301	6.8e-37	0.7027027027027027

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	1.68e-111	3	299	4	300	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	3.66e-88	1	299	102	405	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
cd06549	GH18_trifunctional	1.98e-34	16	299	24	288	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
smart00636	Glyco_18	6.58e-22	77	301	83	331	Glyco_18 domain.
pfam00704	Glyco_hydro_18	1.71e-20	77	301	80	304	Glycosyl hydrolases family 18.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOX63466.1	2.76e-134	1	308	14	321
QAT42169.1	4.97e-128	1	303	4	318
QIB68537.1	2.05e-122	1	303	4	318
QHI71782.1	4.13e-122	1	303	4	318
BCJ94528.1	5.21e-114	1	305	107	411

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4S3K_A	1.08e-67	23	301	135	412	ChainA, Spore germination protein YaaH [Priestia megaterium QM B1551]
3CZ8_A	6.96e-65	9	301	19	308	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
4S3J_A	1.35e-60	21	301	131	410	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]
5JH8_A	1.09e-22	65	301	70	299	Crystalstructure of chitinase from Chromobacterium violaceum ATCC 12472 [Chromobacterium violaceum ATCC 12472]
4Q6T_A	1.81e-19	30	299	37	322	Thecrystal structure of a class V chitininase from Pseudomonas fluorescens Pf-5 [Pseudomonas protegens Pf-5]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37531	2.16e-69	21	301	129	408	Cortical fragment-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleL PE=1 SV=2
O05495	4.12e-63	9	301	111	400	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
P0DPJ9	4.90e-60	21	301	130	409	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1
Q9K3E4	1.92e-59	21	301	130	409	Cortical fragment-lytic enzyme OS=Bacillus cereus OX=1396 GN=sleL PE=1 SV=1
O32258	3.52e-23	30	301	59	328	Uncharacterized glycosylase YvbX OS=Bacillus subtilis (strain 168) OX=224308 GN=yvbX PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002586_01424.