CAZyme Information: MGYG000002587_00769

Basic Information

• Species: Parabacteroides sp900760525
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900760525
• CAZyme ID: MGYG000002587_00769
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
776	MGYG000002587_9|CGC1	86592.97	5.4124

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002587	4423098	MAG	China	Asia

• Gene Location: Start: 2971; End: 5301 Strand: -

Full Sequence      

MKNILVATVLSLSMATNVCAQVQPAIPSDARIEKKVESLLKKMTLEEKVGQMCEITIDVI
TDFNSPNDFKLSEALLDTVIGKYKVGSILNVPLSVAQTKEKWAETIRQIQEKSLQEIGIP
CIYGVDQIHGTTYTLDGTLFPQGINMAATFNRELVRRSCEISAYETKACCIPWTYAPVMD
LGRDPRWPRMWESYGEDSYVNAQMAVEAVKGFQGENPNRIDKYHVATSLKHFMGYGVPVS
GKDRTPSSISEIDLREKHFAPFLECIRNGALTLMVNSGVNNGMPFHANKELLTGWLKEDL
NWDGMIVTDWADINNLCTRDHIAATKKEAIKIAINAGIDMSMVPYEVSFCTWLKELVEEG
EVSMSRIDDAVRRVLRLKYRLGLFENPYWNIEEYNKFGSSEFAQVAQKAAEESLVLLKNE
ENVLPLAQGKTILLTGPNAHSMRSLNGGWSYSWQGDKADECAEAYHTIYEALCNKYGRNH
IIYEPGVTYVTGKGSLWWQENQPEIEKAVQAASKADIIIACIGENSYCETPGNLTDLNLS
GNQKKLIKALAKTGKPIVMVLNEGRPRIINEIVPLAKAVVHIMLPGNYGADALANLLAGD
ANFSGKLPFTYPRLINSLATYDYKPCENIGQMDGNYNYDAVMDVQWPFGAGLSYTTYRYS
NFRVNRSSFTADDELVFSIDVTNTGKMAGKESVLLCSSDLVASLTPDNIRLRGFEKVSLQ
PGETRTVNLKLKGSDLAFVGYDGKWILEKGEFRMTCGSEQIIIQCSDTKKWETPNK

Enzyme Prediction     

EC	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	115	343	2.6e-64	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	1.08e-146	1	757	1	751	beta-glucosidase BglX.
COG1472	BglX	2.40e-81	43	451	1	373	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	1.12e-70	44	377	1	316	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	1.81e-56	138	760	112	772	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	1.94e-52	414	654	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJR68947.1	0.0	1	776	1	776
QJR64682.1	0.0	1	776	1	776
QJR73277.1	0.0	1	776	1	776
AII64988.1	0.0	1	776	1	776
QJR77813.1	0.0	1	776	1	776

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JP0_A	0.0	24	776	5	759	Bacteroidesovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus],5JP0_B Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus]
5XXL_A	2.11e-110	32	764	10	745	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	1.14e-109	32	764	10	745	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5TF0_A	5.68e-106	33	764	10	744	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
6R5I_A	3.15e-102	33	757	4	719	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXU3	0.0	1	776	1	781	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
Q23892	1.58e-160	36	761	80	816	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2
Q56078	1.39e-114	36	764	38	758	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	2.88e-113	36	764	38	758	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH0	6.01e-105	28	758	29	708	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000262	0.999075	0.000197	0.000156	0.000144	0.000139

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002587_00769.