CAZyme Information: MGYG000002587_03389

Basic Information

• Species: Parabacteroides sp900760525
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900760525
• CAZyme ID: MGYG000002587_03389
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
859		97163.91	5.4997

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002587	4423098	MAG	China	Asia

• Gene Location: Start: 3238; End: 5817 Strand: -

Full Sequence      

MGKKNTLLICSLAFLSLLGCKGKNELTIPVNLRTEYLREPIGLDTKNPRFTWEYKGGEKN
FLASRSEIRIGTSPDNLQPYTGNMTLEPHTRYYWNVTVWDRDGDICETSETATFETAKFN
PSDWSGKWITDSHDKEFEPAPMFRKAFTLEKEVKEARVYVAAAGYYDLFINGKRVGENYL
DPGYTHFDKRILYVTHDVTPLLKKGENAVASVLGNGWHNIQSKAVWDFETARWRNRPRML
CELRFRYTDGTTEVIVTDESWRTATGPYTYNNIYSGDKYDATLEEDGWNAEGFDDSKWAP
VQITEAPAPLLVAQQMPGIRITEELSPVSMKKFSDKLYVFSFEKNFAGLSRLKVKGAPGT
RITLKHGELLKPDGRLEPGNIDVYYHPVKPGEVFQMDVFTLKGTGEEEIFMPSFAYHGFQ
HVEVESSAPVTLTKESLTGLFMHTAVEPAGSFSCSDPLLNKIWKATMEAYRSNLHSIPTD
CPQREKNGWTADAHVAIDLGLLGFDGITLYEKWMNDFIDNQREAGEISGIIPSSGWGYGE
WPGPVWDAAMFIIPNALYNYYGETRSIENLYPTMLRYLDYLKAKEKDGGYLTFGLGDWVY
WKSTTDNTYTSTAYYYLDYTLMARFAALLGKDATPYRQKADELKALVNRKFFNSETGVYA
EGTQTAQAIALYLGIVPEGKEQLVADKLCEVVRANNHFLDFGLLGSKSVPAMLTRYGYVE
DAMKMITKTEAPSWGYWVETMGYTTLPETWTLSPQFRDASLNHVFMGDVSAWMMNQLAGI
NYDAAEPGFRHILITPHFVEGMDWAKGEYRSVRGLISSQWKREGDKVTLTVTIPSGCTAE
IRVGDKTKTVGSGTHVNTF

Enzyme Prediction     

No EC number prediction in MGYG000002587_03389.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	331	842	1.7e-151	0.9940476190476191
CBM67	127	306	1.3e-43	0.9545454545454546

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	4.00e-105	449	773	3	336	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	6.62e-77	151	323	1	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	1.11e-25	331	443	1	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.12e-18	786	856	6	76	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
PRK10137	PRK10137	3.81e-04	613	728	582	738	alpha-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT48046.1	0.0	1	859	1	859
QUT19200.1	0.0	4	859	2	856
AST53792.1	0.0	4	859	4	858
QUT95157.1	0.0	4	859	4	858
QJE27359.1	0.0	4	859	2	856

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	7.26e-155	29	843	32	898	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	6.52e-109	35	841	12	992	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	6.07e-93	35	855	10	861	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	4.44e-109	19	841	19	904	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
Q82PP4	2.81e-108	35	841	12	992	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
P9WF03	2.48e-103	29	840	31	875	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KNB2	1.38e-94	14	843	20	878	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000010	1.000060	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002587_03389.