CAZyme Information: MGYG000002589_00667

Basic Information

• Species: CAG-110 sp900540635
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-110; CAG-110 sp900540635
• CAZyme ID: MGYG000002589_00667
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
801	MGYG000002589_5|CGC3	91283.73	5.1273

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002589	2786078	MAG	China	Asia

• Gene Location: Start: 63222; End: 65627 Strand: +

Full Sequence      

MIEVKDTGIKSYHPDMDGDPLYVTKGNCHYSHEGTKDFLDYITAYQPEDGGVTFLVNTFR
GAKAQVRIRFVSPTAFRFQMFPHLVQPKLNEVFGFAPVSGVQVTEESLFIVVKTERVTLR
LRKCPWEMTVELDGELLTMEQIKDHNVDQKYKAVPVGFTVGDDGRILNAFETMYMYCDEA
FYGFGEKFTSFNKRGQKITVWQQDAQSTNSDVSYKGMPYFMSSEGYSVLMNTYTRTHFNM
GASSGVSYTMETEDPYLDYYMFCNRDYKGLIRDYTALSGRSAMIPRWAFGFWMSRMSYMS
RQEVEEIVDQMAKFGMSVDVIHIDGWLDTMQPDGGKELLCFDEKRFPDPEGMIQSLREKG
IHLSLWMFPYVHAVDREGRFSNQFKIMNERGYLVKNQKGEPYLFSPGEGDAGNWKVAALD
FTNPEFVAYMKERVKRLMRMGVGVIKTDFSEEIPEDAVMYDGSTGLESHNKYTLLYAKTI
YEASREAKEEMGQKALLWGRSGYAGSQNYPANWAGDSSAAKNNLYAILNGGLSMGVSGVS
FWGFDIGGFYNCDYSGKRVIPDDEDYIRSVQMGLMSPLSRSHGQSTPREPWIYSETAQKA
FLKINKTRYAMLPYLYSVGYETTREGIPMMRAMLLEYPNDLNVCNLSTQYMLGGSVLVAP
VFDQKKHNVYLPKGSWIDLETGRRLEGNAWIEYPQKIDVIPMFLRENTMMATLKKVPEHI
PEENFQGLEIVMNITGTIDQDYFDDGVEGKFHATVQDGTLEITLRDIPAESFKIYADTEI
SKVIVNGQARSVTKCANVFTA

Enzyme Prediction     

No EC number prediction in MGYG000002589_00667.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	259	709	1.2e-124	0.9953161592505855

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1501	YicI	6.87e-147	76	763	58	727	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
PRK10658	PRK10658	1.15e-141	101	707	92	665	putative alpha-glucosidase; Provisional
pfam01055	Glyco_hydro_31	5.38e-140	260	709	1	441	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
cd06593	GH31_xylosidase_YicI	2.92e-139	279	611	1	308	alpha-xylosidase YicI-like. YicI alpha-xylosidase is a glycosyl hydrolase family 31 (GH31) enzyme that catalyzes the release of an alpha-xylosyl residue from the non-reducing end of alpha-xyloside substrates such as alpha-xylosyl fluoride and isoprimeverose. YicI forms a homohexamer (a trimer of dimers). All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The YicI family corresponds to subgroup 4 in the Ernst et al classification of GH31 enzymes.
PRK10426	PRK10426	1.39e-83	178	713	81	626	alpha-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLG28956.1	7.38e-141	42	722	9	703
BAL98615.1	7.72e-121	58	710	44	697
BBH92069.1	2.87e-118	82	710	139	739
BBH87733.1	1.03e-117	110	788	105	766
BAS26283.1	1.30e-117	178	721	184	716

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2F2H_A	5.55e-101	126	711	118	670	Structureof the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_B Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_C Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_D Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_E Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_F Structure of the YicI thiosugar Michaelis complex [Escherichia coli]
1XSI_A	6.22e-101	126	711	118	670	Structureof a Family 31 alpha glycosidase [Escherichia coli],1XSI_B Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_C Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_D Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_E Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_F Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_A Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_B Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_C Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_D Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_E Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_F Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSK_A Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_B Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_C Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_D Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_E Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_F Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli]
5F7C_A	6.41e-98	127	720	151	722	Crystalstructure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_B Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_C Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_D Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
1WE5_A	1.27e-90	126	711	118	670	CrystalStructure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_B Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_C Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_D Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_E Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_F Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli]
5F7U_A	2.14e-78	94	787	171	890	Cycloalternan-formingenzyme from Listeria monocytogenes in complex with pentasaccharide substrate [Listeria monocytogenes EGD-e]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P31434	2.97e-100	126	711	118	670	Alpha-xylosidase OS=Escherichia coli (strain K12) OX=83333 GN=yicI PE=1 SV=2
Q5AW25	1.07e-95	179	741	178	724	Alpha-xylosidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=agdD PE=1 SV=1
P96793	1.09e-89	116	715	107	679	Alpha-xylosidase XylQ OS=Lactiplantibacillus pentosus OX=1589 GN=xylQ PE=1 SV=1
Q9F234	1.29e-68	178	711	144	675	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
Q9P999	1.29e-57	179	715	112	627	Alpha-xylosidase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=xylS PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002589_00667.